KEGG   Bradyrhizobium sp. ORS 278: BRADO5133Help
Entry
BRADO5133         CDS       T00516                                 

Gene name
thiD
Definition
(GenBank) bifunctional: hydroxy-methylpyrimidine kinase (HMP kinase); hydroxy-phosphomethylpyrimidine kinase (HMP-P kinase) (EC:2.7.1.49 2.7.4.7)
  KO
K00941  
hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BRADO5133 (thiD)
Enzymes [BR:bra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     BRADO5133 (thiD)
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphomethylpyrimidine kinase
     BRADO5133 (thiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(5331475..5332275)
Genome map
AA seq 266 aa AA seqDB search
MSTPIALTIAGSDSSGGAGIQADLKTFAALSVYGASVLTALTAQNTRGVTGVHLVPPDFV
AAQIDAVFDDLAVGAVKIGMVAQGPIADAIAASLARWRPAHIVLDPVMVATSGARLLPED
AIEALRSRLIPQASLITPNLPEAAALLGEPVAETDEAIAAQGRRLLALGCPAVLIKGGHG
QGAESTDHLITSDRSIPLPAPRVGTKNTHGTGCSLSSAVAAGLAKGEDLETAVRNAKAFI
SGAIAAADRFTVGRGHGPVHHLYRFY
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccatagccctcaccatcgccggctcggattcctcgggaggagccggcatt
caggccgatctgaagaccttcgccgcgctgtcggtttatggtgcctcggtgctgacggcg
ctgaccgcgcagaacacccggggtgtcaccggcgtgcatctggtgccgcccgatttcgtc
gccgcgcagatcgacgccgtgttcgacgatctcgccgtcggcgcggtcaagatcggcatg
gtggcgcaggggccgattgccgacgccatcgccgccagcctggcgcgctggcgccccgcg
cacatcgtgctcgatccggtgatggtggcaacctccggggcgcggctgttgccggaggac
gcgatcgaggcgctgcgcagccggctcatcccgcaggcgtcgctgatcacgccaaacctg
ccggaagcggccgcgctgctcggcgagccggttgccgagaccgacgaagcgattgccgcg
cagggccgccgcttgctcgcgctcggctgtccggcggtgctgatcaagggcggacatggg
cagggcgccgaaagcaccgatcacctgatcacgtccgataggagcatcccgctgccggcg
ccgcgcgtcggcacgaagaacacgcacggcaccggctgctcgctgtcatcggcggtcgcc
gcggggctcgcgaagggcgaggatctggagaccgccgtgcgcaacgccaaggccttcatc
tccggcgcgattgcggccgccgaccgcttcacggtgggccgcggccacggcccggtgcat
catctctatcggttctattga

DBGET integrated database retrieval system