KEGG   Bradyrhizobium sp. ORS 278: BRADO5308Help
Entry
BRADO5308         CDS       T00516                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BRADO5308
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRADO5308
  Lipid metabolism
   00071 Fatty acid degradation
    BRADO5308
  Amino acid metabolism
   00350 Tyrosine metabolism
    BRADO5308
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BRADO5308
   00626 Naphthalene degradation
    BRADO5308
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BRADO5308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
5522058..5523053
Genome map
AA seq 331 aa AA seqDB search
MHAMVLQKPGGPLRLETLADPEPRPGEIRVRVSACGVCRTDLHLLDGELPDIVYPIIPGH
EIVGHIDRIGAGVTTHRLGTRVGIPWLGHTCGLCPFCARGMENLCDAPGLTGYTRHGGYA
THAVADASYAFPLEGLGDDVAAAPLLCAGLIGWRSLVMAGDAEHLGIFGFGAAGHIVVQV
ARWQGRKVYAFTRRDDRTAQDLALQLGATWAGPSDARPDVPLDAAIIYAPAGELVPAALK
AVRKGGRVVCAGIHMSEIPSFPYSLLWGERHVMSVANLTRQDGLDFLRVAREAQIRTHTT
PYPLTDANDVLNRLRHGDVLGAAVLVPDFGF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgatggtgttgcaaaaaccggggggacctcttcgacttgagacgcttgccgat
cctgagccgcgtcctggtgagattcgggtccgggtcagcgcgtgcggtgtctgccgcacc
gatctgcatcttctcgatggcgaactgcccgacatcgtctatccgatcattccgggtcac
gagatcgtcggccacatcgaccgtatcggagcaggcgtcacgacgcatcggcttgggaca
cgggtcggaattccctggctgggccacacctgtggactctgccccttctgcgcgcgtgga
atggagaatctctgcgacgcgcccggattgaccggctacacgcgccatggcggatacgcc
acgcacgccgttgccgatgcgagttatgcgttcccgctagaaggtctgggcgacgacgtc
gccgctgcacccttgctgtgcgccggcctgatcggctggcgatcgctggtcatggccggc
gacgcagagcacttgggcatcttcggtttcggagccgcaggtcatatcgtcgtccaagtc
gcccgctggcaggggcgcaaggtctatgcgttcacccgacgagacgatcggaccgcgcag
gatctcgcgctccaactcggtgcgacatgggcgggtccgtccgacgcgcgtcctgatgtt
ccactggacgcggccattatttatgcgcctgccggtgagcttgtccccgccgcattgaaa
gcggtgcggaagggtggtcgggtcgtgtgcgcgggcatccacatgagcgagattccgagc
ttcccctactcgcttctctggggcgaacgtcacgtgatgtctgttgccaacctgactcga
caggatggtctggatttcctgcgtgtcgctcgtgaggcgcagatccgcactcacacgacg
ccgtatccactgaccgatgcgaatgatgttctgaaccgcttgaggcacggcgacgttctc
ggggccgccgttctcgttccggacttcggattctga

  All links  
No link information was found.   
DBGET integrated database retrieval system