KEGG   Bradyrhizobium sp. ORS 278: BRADO5323Help
Entry
BRADO5323         CDS       T00516                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BRADO5323
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BRADO5323
Enzymes [BR:bra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BRADO5323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5539778..5540752)
Genome map
AA seq 324 aa AA seqDB search
MAPSDPASPHRIAVLGAPIDLGASVRGTLMGPAALRTAGLVPVLESLGLEVTDYGDVGIA
DMAELGDDPPSSAKHYRQIQRWSRVLARRSYELAQTGALPVFLGGDHSLSMGSVNGIARH
CRDIGRELFVLWLDAHADYNTPATTITANMHGMSAAFLCGEPGLDGLLGDEPRVGISSAQ
LELFGIRSIDKAEKDLLRLRRVSIADMRAIDEFGVGVLMRRVLDKVRARDGVLHVSFDVD
FLDPDVAPGVGTTVPGGATYREAHLIMELLHDSGLVCSVDIVELNPFLDDRGKTARVAVE
LIGSLFGQQITDRPTPTNAIVPDQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtggcaccatcagacccagcatcgccgcaccgcatcgccgtgctcggtgcaccgatcgat
ctcggcgcctccgtccgggggacgctgatgggccccgcggcgttgcggaccgcgggtctc
gtccctgtgctggaaagccttgggctcgaggtcacggactacggcgatgtcggcattgcc
gacatggccgagctcggtgatgacccgccttccagcgccaagcattatcgccagatccag
cgctggtcgcgggtgctggcgcgccgcagctacgaattggcgcagaccggagctcttcct
gtgttcctggggggcgatcattccctgtcgatgggatcggtcaatggcatcgcccgtcac
tgccgcgatatcgggcgtgagctgttcgtgctctggctcgatgcgcatgccgactacaac
acgcctgcgacgaccatcaccgccaacatgcacggcatgtcggcggcgttcctgtgcggc
gagccggggctggatgggctgctcggcgacgagccgcgggtcggcatctcatcggcgcag
ctcgagctgttcggcatccgctcgatcgacaaggcggagaaggatctgctgcggctgcgg
cgcgtcagcatcgccgacatgcgcgcgatcgacgagttcggcgtaggtgtcctgatgcgc
agggtgctcgacaaggtccgtgcccgcgacggcgttctgcatgtcagcttcgacgtcgac
tttctcgatcccgacgtggcgcccggcgtggggaccaccgtgccgggtggcgcgacctat
cgcgaggcgcatctcatcatggagctgctgcacgattctggactggtctgctcggtcgac
atcgtcgagctcaatccgtttctcgacgatcgcggcaagaccgcgcgtgtcgccgtcgag
ctgatcggcagcctgttcggtcagcagatcaccgaccggcccaccccgaccaatgcgatc
gtgccggatcaatag

DBGET integrated database retrieval system