KEGG   Bradyrhizobium sp. ORS 278: BRADO5323Help
Entry
BRADO5323         CDS       T00516                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00220  Arginine biosynthesis
bra00330  Arginine and proline metabolism
bra01100  Metabolic pathways
bra01110  Biosynthesis of secondary metabolites
bra01130  Biosynthesis of antibiotics
bra01230  Biosynthesis of amino acids
Module
bra_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BRADO5323
   00330 Arginine and proline metabolism
    BRADO5323
Enzymes [BR:bra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BRADO5323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAL79004
RhizoBase: BRADO5323
UniProt: A4YYM8
Position
complement(5539778..5540752)
Genome map
AA seq 324 aa AA seqDB search
MAPSDPASPHRIAVLGAPIDLGASVRGTLMGPAALRTAGLVPVLESLGLEVTDYGDVGIA
DMAELGDDPPSSAKHYRQIQRWSRVLARRSYELAQTGALPVFLGGDHSLSMGSVNGIARH
CRDIGRELFVLWLDAHADYNTPATTITANMHGMSAAFLCGEPGLDGLLGDEPRVGISSAQ
LELFGIRSIDKAEKDLLRLRRVSIADMRAIDEFGVGVLMRRVLDKVRARDGVLHVSFDVD
FLDPDVAPGVGTTVPGGATYREAHLIMELLHDSGLVCSVDIVELNPFLDDRGKTARVAVE
LIGSLFGQQITDRPTPTNAIVPDQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtggcaccatcagacccagcatcgccgcaccgcatcgccgtgctcggtgcaccgatcgat
ctcggcgcctccgtccgggggacgctgatgggccccgcggcgttgcggaccgcgggtctc
gtccctgtgctggaaagccttgggctcgaggtcacggactacggcgatgtcggcattgcc
gacatggccgagctcggtgatgacccgccttccagcgccaagcattatcgccagatccag
cgctggtcgcgggtgctggcgcgccgcagctacgaattggcgcagaccggagctcttcct
gtgttcctggggggcgatcattccctgtcgatgggatcggtcaatggcatcgcccgtcac
tgccgcgatatcgggcgtgagctgttcgtgctctggctcgatgcgcatgccgactacaac
acgcctgcgacgaccatcaccgccaacatgcacggcatgtcggcggcgttcctgtgcggc
gagccggggctggatgggctgctcggcgacgagccgcgggtcggcatctcatcggcgcag
ctcgagctgttcggcatccgctcgatcgacaaggcggagaaggatctgctgcggctgcgg
cgcgtcagcatcgccgacatgcgcgcgatcgacgagttcggcgtaggtgtcctgatgcgc
agggtgctcgacaaggtccgtgcccgcgacggcgttctgcatgtcagcttcgacgtcgac
tttctcgatcccgacgtggcgcccggcgtggggaccaccgtgccgggtggcgcgacctat
cgcgaggcgcatctcatcatggagctgctgcacgattctggactggtctgctcggtcgac
atcgtcgagctcaatccgtttctcgacgatcgcggcaagaccgcgcgtgtcgccgtcgag
ctgatcggcagcctgttcggtcagcagatcaccgaccggcccaccccgaccaatgcgatc
gtgccggatcaatag

DBGET integrated database retrieval system