KEGG   Bradyrhizobium sp. ORS 278: BRADO5576Help
Entry
BRADO5576         CDS       T00516                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bra00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bra00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5760730..5761242)
Genome map
AA seq 170 aa AA seqDB search
MIEIVQIVAVAENGVIGAAGAIPWRQKSDMQRFKALTMGRPIVMGRKTFVSFPRRPLPGR
TNIIVTRDAAFRAAGAIVTHRIAEALTVARGDALRRSAAEIAIVGGAEIYTATLPLTDRL
EITEVHARPPGDTLFPAIDPAQWEEVARERHASGPDDQADFSYVTYRRKR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagatcgtgcagatcgtcgcggtcgccgagaacggcgtgatcggcgctgccggc
gccattccctggcggcagaagagcgacatgcagcgcttcaaggcgctgaccatgggacgg
ccgatcgtcatgggccgcaagaccttcgtgtcatttcctcgccggccgttgccgggtcgg
accaacatcatcgtcacccgcgacgccgcgtttcgcgccgcgggcgccatcgtgactcac
cgcatcgccgaagcgctcaccgtcgcgcggggcgatgcgctgcggcgttcggccgcggaa
atcgccatcgtcggcggcgccgagatctatacggcgaccctgccattgaccgacagattg
gagatcaccgaggtccacgcgcggccgccgggcgacacgctgtttccggcgatcgatccg
gcgcagtgggaggaggtggcgcgcgagcgtcacgcgtcggggccggacgatcaggccgac
ttctcttacgtcacctatcgccggaagcgctga

DBGET integrated database retrieval system