KEGG   Bradyrhizobium sp. ORS 278: BRADO5815Help
Entry
BRADO5815         CDS       T00516                                 

Definition
(GenBank) putative 4-alpha-glucanotransferase (malQ-like)
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00500  Starch and sucrose metabolism
bra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRADO5815
Enzymes [BR:bra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BRADO5815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: CAL79479
RhizoBase: BRADO5815
UniProt: A4Z003
Position
complement(6022804..6024756)
Genome map
AA seq 650 aa AA seqDB search
MDLYSQAHSLGILTEFYDGQGNRRVTDEAALKIIVEAFPRPTPHRLLSGAIVIRPAQPTR
SRLSDAAKLPVQWTVRRGDIAVARGETGEAFIEWPVDLPAGSYRVELLDASSCREELPLL
VAPDKAFSGDFDRVWLLAVQLYGIKSRRNWGMGDFTDLANLIETCAKLGADGVGLNPLHA
LFDDRPGDFSPYAPNSRLFLNALYVDVEQAPGFADGPHSKVLEPLRQAELVDYKGVAALK
WPALRAAFDAFMAAPDAADAAEFKAYRAERGDLLARFTCFEVLRHRFQKPWWEWPEGWRQ
PDAARCAALLNGPDAREADFVAYVQWLAERQLRRCKDLAHRLGMKVGLYLDVAVGVQSDG
FDAWNEQGAISRTLSVGAPPDPLNTVGQNWGLAGFNAPGLELRNFEPFREMIRASMRHAG
AIRLDHVLGLKRLYLVPHGFPAKQGAYVQMPFDALLAATAMESVASQCIVIGEDLGTVPE
GFREQMADWGLWSYKVMIFERDDNGRFRDVDYYPPNALVTLNTHDLSTYAGWRSFGDLKT
KRGLDIDPGETDQDRWHALGLWDEVLRHNGIHNNDVHSAIGFLSRTRSRLLAISLEDLLG
VVDQPNIPGTIDEHPNWRRKMPIDLEDITGAVGVDALKAATAERISPASV
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggatctctacagccaagctcacagtctcggaatcctgacagaattctatgacggtcag
ggcaatcgccgcgtcaccgacgaggccgccctcaagatcatcgtcgaggcctttcccagg
ccgacgccgcatcggctgctcagcggcgcgatcgtgattcggccggcccagccgacgcga
agccggctgagcgatgcggccaagttgccggtccagtggacggtcaggcgcggcgatatc
gccgtcgcgcgcggcgagacgggtgaggcgttcatcgaatggccggtggatcttcccgcc
ggcagctatcgcgtcgagctcctggatgcgtcgtcatgccgcgaggagttgccgctgctg
gtcgcacccgacaaggcgttttcgggcgatttcgatcgcgtctggctgctggccgtgcag
ctctatggcatcaaatcgcgccgcaactgggggatgggcgacttcaccgacctcgccaac
ctcatcgagacctgcgccaagctcggcgccgatggcgtcggcctcaacccgctgcatgcg
ctgttcgacgatcgtcccggcgatttcagcccctatgcgccgaacagccggctgttcctc
aatgcgctctatgtcgacgtcgagcaggcgccgggctttgccgacgggccccatagcaag
gtgctggagccgctgcggcaggccgaactggtcgactacaagggcgtggcggcgttgaaa
tggccggcgctgcgcgcggccttcgatgcgttcatggccgcgcccgacgctgccgatgcg
gccgagttcaaggcctaccgcgccgagcgcggcgatcttctggcgcgcttcacctgtttc
gaggtgctgcggcatcgctttcagaagccttggtgggagtggcccgaggggtggcggcag
ccggatgcggcgcgctgcgcggcgctgctcaacggcccggatgcgcgcgaggcggatttc
gttgcctatgtgcagtggctggccgagcggcaactgcgccgttgcaaggatcttgcccat
cgcctgggcatgaaggtcggcctgtatctcgacgttgccgtcggcgttcaatccgacggt
ttcgatgcctggaacgagcagggcgcaatctcgcgcaccctgtcggtcggtgcgccgccg
gatccgctgaatacggtcgggcagaattggggcttggccggcttcaatgcacctgggctc
gagctcaggaattttgagcccttcagagagatgatccgtgcctcgatgcgccatgccggc
gcgatccggctcgatcatgtgctcgggctgaagcggctctatctggtgccgcatggtttt
ccggccaagcagggcgcctatgtgcagatgccgttcgacgcgctgctcgccgccaccgcg
atggagagcgtcgccagccagtgcatcgtcatcggcgaggatctcggcacggtgccggag
gggttccgcgagcagatggccgattggggactgtggtcctacaaggtcatgatcttcgag
cgtgacgacaacggccgcttccgggacgtcgactactatccgccgaacgcgctggtcacg
ctgaacacccacgatctctccacctatgccggctggcgctcgttcggcgacctcaagacc
aagcgcgggctggacatcgatcccggcgagaccgaccaggatcgctggcatgcgctcggg
ctgtgggacgaggtgctccgccacaacgggatccacaacaacgacgttcactccgcgatc
ggcttcctgtcgcggacgcggtcgcggctgctggcgatctcgctggaggatctgctcggc
gtcgtcgatcagccgaatatcccaggcaccatcgacgagcatccgaactggcgtcgcaag
atgccgatcgacctggaggacatcaccggtgccgtgggcgtcgacgcgctcaaggccgca
accgctgaacggatcagcccggccagcgtttaa

DBGET integrated database retrieval system