KEGG   Bradyrhizobium sp. ORS 278: BRADO5823Help
Entry
BRADO5823         CDS       T00516                                 

Definition
(GenBank) putative ATP-dependent DNA ligase (EC:6.5.1.1)
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bra00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BRADO5823
Enzymes [BR:bra01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BRADO5823
DNA repair and recombination proteins [BR:bra03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BRADO5823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(6037908..6040622)
Genome map
AA seq 904 aa AA seqDB search
MALKKLSTYRKKRDFEKTAEPSGDARIAPAARPRFVIQKHDATRLHYDLRLEFDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPEGEYGGGTVMLWDRGYWESDDPERGF
TKGDLKFTLEGEKLHGSWVLVRMRHDRTGGKRTNWLLIKHRDEFAREGAANDVLDADKSV
ASGRTMEQIAAGKGRAPKPFMLAKRQRMNADAIWHSNRSDGETKTSKVSTKAASSRTKAA
KAGRAKSSRVSKMAEPKTVSSLPDFVPPELCTSVAQPPSGEGWAHEIKFDGYRVQIRVED
GQAALKTRKGLDWTAKFGVIAEAAAKLPDAIIDGEIVALDKDGNPNFSALQAAISAGQTD
ELVFFAFDLMFVEEFDLRRQPLRERKARLAKLLKANIKGKTPVIRYVEHFESDGEAVLES
ARKLSLEGIVSKKLDSAYHSGRTESWTKAKTRPGHEVVVGGWKTTNGKFRSLMVGVNKDD
HLAYVGIVGTGFGQDTVKAIMPALKAAASDKSPFSGKNAPRKAREVHWLKPELVAEIEFA
GFTGDGNVRQASFKGLRQDKPAREVVAEEPVVAAKVTKPVARAAATVATGGTTVHKTPSR
TKGAATVMGVAISKPDKALWPDAGDGEPVTKLDLATYLEAVGDWMIEHLKGRPCSIVRAP
DGIGGERFFQRHGMQGMSDLLELVKVSGDRKPYLQIDRVEGLIAVAQVAAVELHPWNCAP
DAYDVPGRLVFDLDPAPNVAFEEVIAAAKEMRQRLKTLGLESFCKTTGGKGLHVVTPLLH
GARDQVTWPEAKAFAQGVCQWMANDSPDDYLLNMSKKLRKGKIFLDYLRNDRMSTAVAVL
SPRAREGATVSMPVTWAQVKNGLDPKRYTIRTVPALLAKTKAWDGYDDAAGAIRPAIRKL
TDTL
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctcaagaagctttccacctatcgcaagaagcgcgatttcgaaaaaacggcagag
ccgtccggtgacgccaggatcgcgcccgccgcgcggccgcgcttcgtcatccagaagcat
gacgccacccggctccattacgatctcaggctcgaattcgacggcgtcttcaagtcctgg
gcagtgaccaaggggccgtcgctcgatccgcacgacaagcgcctcgcggttgaggtcgag
gatcatccgctcgactatggcgatttcgaaggcacgattcctgaaggcgaatatggcggc
ggcacggtgatgctgtgggaccgcggctattgggagagcgatgatcccgaacgcggcttc
acgaagggcgacctgaaatttacgcttgagggtgagaagctgcacggcagctgggtgctg
gtgcggatgcgccacgaccgcaccggcggcaagcgcaccaactggctgctgatcaagcat
cgcgacgagttcgcccgggaaggcgcggccaacgacgttctcgatgccgacaagtcggtg
gcctcgggtcgcaccatggagcagatcgcggccggcaagggcagggcaccgaagccgttc
atgctcgccaagaggcagcgcatgaatgccgacgccatatggcactccaatcgcagcgac
ggcgaaacgaagaccagcaaggtgtcgaccaaggcagcatcgtcgagaacgaaggccgcg
aaggcagggagggcgaagtcctcgcgcgtgtcgaagatggcggagccaaagaccgtctcg
tcgctgccagacttcgtgccgcccgagctgtgcacctccgtcgcacagccgcccagcggc
gagggctgggcgcacgagatcaagttcgacggctaccgcgtgcagatccgggtcgaggat
ggccaggcggcgctgaagacgcgcaagggcctcgactggaccgccaagttcggcgtgatc
gccgaggcggctgccaagctgccggatgcgatcatcgacggcgagatcgttgcgctcgac
aaggatggtaacccgaacttctccgcgctgcaggcggcgatctcggccgggcagaccgac
gagttggtgttctttgccttcgacctgatgttcgtcgaggagttcgacctgcgccgccag
ccgctccgcgagcgcaaagcacgcctggccaagctcttgaaggccaacatcaagggcaag
acgcccgtgatccgttacgtcgagcatttcgagagcgacggtgaagcggtgctggagtcg
gcgcgcaagctatccctcgaagggatcgtctcgaagaagctggactcggcctatcactcc
ggtcgcaccgagagctggaccaaggcgaagacccgtcccggccacgaggtcgtggtcggc
ggctggaagaccaccaacggcaaattccgctcgttgatggtcggcgtcaacaaggacgat
catctcgcttatgtcggcatcgtcggcaccggcttcggtcaggatacggtgaaggcgatc
atgcctgcgctgaaggcggccgcatccgacaagagtccgttcagcggcaagaatgccccg
cgcaaggcgcgcgaggtgcattggctcaagcccgagctggtcgccgagatcgagttcgca
ggcttcaccggagacggcaatgtgagacaggcctcgttcaaggggctgcgtcaggacaag
ccggcgcgcgaggtcgtcgcggaggagccggtggtcgcggccaaggtgacgaagccggtg
gcgcgggccgccgccacggtcgcgaccggcggcaccacggtccacaagacgccgtcacgc
accaagggcgcggccacggtgatgggcgttgcgatctcgaagccggacaaggcgctatgg
ccggatgcgggcgatggcgagccggtcacgaagctcgatctcgccacctatctggaagcg
gtcggcgactggatgatcgagcatctgaagggccggccgtgctcgatcgtccgtgcgccc
gacggaatcggcggcgagaggttttttcagcggcacggcatgcagggcatgtcggacctg
ctcgaactggtaaaggtgtccggagaccggaagccttatctgcagatcgatcgcgttgag
ggactgatcgcggtggcgcaagtggccgcggtcgagctgcatccgtggaattgtgcgccc
gatgcctacgatgtgccgggccgcctggtgttcgatctcgatccggcacccaacgttgca
ttcgaggaggtgatcgcggcggccaaggagatgcggcagcgtctcaagacgctcggcctg
gagagcttctgcaagaccaccggcggcaagggcctgcatgtcgtgacaccgctgctgcat
ggcgcgcgcgaccaggtgacatggccggaggcgaaagcgtttgcgcagggcgtgtgccag
tggatggccaatgacagccccgacgactatttgctcaacatgtcgaagaagctgcgcaag
ggaaagatcttcctcgactatctgcgcaacgatcggatgtcgacggcggttgccgtgctg
tcgccgcgggcgcgcgagggcgcgacggtgtcgatgccggtgacgtgggcgcaggtgaag
aacggacttgatcccaagcgctacaccatccgcaccgtaccggcgctgctggccaagacc
aaggcgtgggatggctacgatgatgcagccggagcgatcaggccggcaatcaggaagctg
accgacacgttgtga

DBGET integrated database retrieval system