KEGG   Bradyrhizobium sp. ORS 278: BRADO6231Help
Entry
BRADO6231         CDS       T00516                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bra  Bradyrhizobium sp. ORS 278
Brite
Enzymes [BR:bra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BRADO6231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6473172..6474047)
Genome map
AA seq 291 aa AA seqDB search
MDQSEKYRTFYAKLICAAAKLEDPRIEEAFRSIPREPFAGPGPWWMILGGGHPYVQTPDD
DPAFLYQNLLLALDYERGINIGQPGAHAMWLGACGIKPADTVVHVGVGSGYYTAILAHLV
GPHGRVHAYEIDEAMAARARENLEHVPQVELRLQSGAGADLPPADVIYVCAGAAQPSRSW
LDGLRPGGRLLFPLAPQDVFGGMLLITRPGQGTVWPAKFVSRAGFIGCVGLQDENAGRRL
SAAFSTDWAAVRSLRLDGAPDESCWFAGDGWWLSTAEALGSSDPSEHDPRR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtggatcaatcagagaaataccgcacgttctacgccaagctgatctgcgccgccgccaag
ctcgaggatccccggatcgaggaggcgttccgcagcatcccgcgcgagccattcgcgggg
ccggggccctggtggatgatcctcggcggcggtcatccttatgtgcagacgcccgatgac
gatcctgccttcctctatcagaacctgctgctcgcgctggactacgaacgcggcatcaat
atcggccagcctggcgcacatgcgatgtggctgggcgcctgcggcatcaagccggccgac
accgtggtgcatgtcggggtcggcagcggctactacacggcgatcctcgcgcatctggtc
ggtccgcacgggcgggtccatgcctatgagatcgacgaggcgatggccgcgcgagcgcgc
gagaacctcgagcatgtgccgcaggtggagctgcggctgcaatccggcgccggggcggac
ctgccgccggccgacgtgatctatgtctgtgccggcgcggcgcagccgagccggtcctgg
ctcgatggcttgcggccgggcggacggctattgtttcccttggcgccgcaggacgtcttc
ggcggcatgttgctgatcacgcgtcccggtcaaggcacggtctggccggcgaaattcgtc
agtcgcgccgggtttatcggatgcgtcggcctgcaggacgagaacgcgggccgccgcttg
agcgcggcgttctcgacggattgggccgccgtgcgctcgttgcgtctcgacggagcgccg
gacgagagctgctggttcgccggcgacggctggtggctatcgacggcggaggctttgggg
tcctctgatccatccgagcacgatccgcgacgctga

DBGET integrated database retrieval system