KEGG   Bradyrhizobium sp. ORS 278: BRADO6235Help
Entry
BRADO6235         CDS       T00516                                 

Definition
(RefSeq) lysophospholipase L2 (EC:3.1.1.5)
  KO
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRADO6235
Enzymes [BR:bra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BRADO6235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6476734..6477681)
Genome map
AA seq 315 aa AA seqDB search
MTLVSIPANPVPENATAGTIKTPDGAELRFARWAPPAGRKGTVCVFTGRSEMIEKYFETV
RDLRDRGFAVAIIDWRGQGHSSRRLRDSRKGYVRSFSDYELDVETFVTEVVLPDCPPPYF
ALAHSMGGTVLLRLAHSGKRWFDRVVLSAPMIDLPGKRTSLPARLLLRAMRIAGQGGRTV
PGGNDEISGLAPFVNNPLTSDPVRYARNAAILEEDPTLGIASPTVAWADAAFSAMATFRG
MTYPSQIRQPILMLAASSDTVVSTAAIEEFAYHLRAGSHLVIAGAKHEILQEQDRYRSQF
WAAFDAFVPGTPLFG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtctcgattcccgccaatcccgtgcccgagaacgccaccgccggcaccatc
aagacccctgatggcgccgagctgcgctttgcgcgctgggcgccgcccgcggggcgcaag
ggcaccgtttgcgtcttcaccggccgcagcgagatgatcgagaagtatttcgagacggtg
cgcgatttgcgcgatcgcggcttcgcggtcgccatcatcgactggcgcggccagggccac
tcgtcgcggcggctgcgcgactcccgcaagggctacgtccgctcgttctccgactacgag
ctcgacgtcgagaccttcgtcaccgaggtcgtgctgcccgattgtccgccgccttacttc
gcgctggcgcattcgatgggcggcacggtgctgctgcggctcgcgcattccggcaagcgc
tggttcgaccgcgtggtgctgtcggcgccgatgatcgacctgccgggcaagcgcacgtcg
ctgccggctcggctcctgctccgcgcgatgcgcatcgcggggcagggcggccgcaccgtg
ccgggtggcaacgacgagatcagcgggctggcgccgttcgtcaacaatccgctgacgtcc
gatcccgtccgctatgcccgcaacgccgcgatcctcgaggaggatccgacgctcggcatc
gcctcgccgacggtcgcctgggccgacgcggcgttctcggcgatggcgaccttccgcggc
atgacctatccgtcgcagatccgccagccgatcctgatgctcgcggcctcgagcgacacc
gtggtgtcgaccgcggccatcgaggaattcgcctatcatctgcgcgccggctcgcacctc
gtcatcgccggcgccaagcacgagatcctgcaggagcaggaccgctaccgttcgcagttc
tgggccgccttcgacgcctttgtgccgggcacgccgctgttcggctga

DBGET integrated database retrieval system