KEGG   Bradyrhizobium sp. ORS 278: BRADO6693Help
Entry
BRADO6693         CDS       T00516                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BRADO6693 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BRADO6693 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BRADO6693 (thrC)
Enzymes [BR:bra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BRADO6693 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6954777..6956192)
Genome map
AA seq 471 aa AA seqDB search
MTRYVSTRGEAPALTFCDVMLTGLARDGGLYVPETWPQLTPATIASFFGRPYWEVAVEVI
KPFVAGEISDAELGRMANEAYATFRHPAVVPLDQTAPHQFVLELFHGPTLAFKDVAMQLI
SRLMDHVLAKRGERTTIVVATSGDTGGAAVDAFAGRDNADLIVLYPHGRISEVQRRMMTT
SGAANVHALAIEGHFDDCQAIVKGLFNHHAFRDAVSLSGVNSINWARIVAQVVYYFTSAV
AVGAPHRAVDFTVPTGNFGDIFAGYVAKRMGLPVRKLRVATNVNDILARTLATGIYEVRE
VHATASPSMDIQVSSNFERLLFEAGGRDAGTVRRLMESLKQSGRFVLPDAMLAAISADFD
AGRADETETAAAIRAAFREAGDLVDPHTAVALAVADRDDTDRSVPNIVLATAHPAKFPDA
VEAACGQRPQLPVWLEGLMSKREDAKIMRNEQAEVEKFIRSVSRAAKQGIA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcgctacgtttcgacccgcggggaggcccccgcgctcaccttctgcgatgtgatg
ctgaccgggctcgcccgggacggcggcctgtacgtgcccgagacctggccgcagctgacg
cccgcgaccatcgcctcgttcttcggcaggccctattgggaggtcgccgtcgaggtcatc
aagccgttcgtcgccggcgagatctccgatgccgaactcggccgcatggccaacgaggcc
tacgccaccttccgccatcccgcggtggtgccgctcgaccagaccgccccgcatcagttc
gtcctcgagctgttccacggcccgaccttggccttcaaggacgtggcgatgcagctgatt
tcgcggctgatggaccacgtgctggccaagcgcggcgagcgcaccacgatcgtggtggcg
acctcaggcgataccggcggcgccgccgtcgacgccttcgccggccgcgacaatgccgat
ttgatcgtgctgtatccgcatggccgcatctccgaggtgcagcggcggatgatgacgacg
tcgggcgccgcgaacgtgcatgcgctggcgatcgaaggccatttcgatgattgccaggcg
atcgtgaagggcctgttcaatcatcatgccttccgtgacgcggtgtcgctgtccggcgtc
aactcgatcaactgggcgcgaatcgtcgcccaggtcgtctactacttcacctcggcggtc
gccgtcggcgcgccgcatcgcgccgtcgacttcaccgtgccgaccggcaatttcggcgat
attttcgccggctacgtcgccaagcgcatgggcctgccggtgcgcaagcttcgtgtcgcc
accaacgtcaacgacattctcgcccgcacgctcgcgaccggcatttacgaggtgcgcgag
gtccacgcgacggcgtcgccgtcgatggatatccaggtgtcctcgaatttcgagcggttg
ttgttcgaggcgggcggccgcgacgccggcacggtgcggcggctgatggagagcctgaag
cagtccggccgcttcgtgctgccggatgcgatgctggcggcgatcagcgccgatttcgac
gccggccgcgccgacgagaccgagacggcggcggcgatccgcgcggccttccgcgaggcc
ggcgatctcgtcgacccgcacacggccgtggcgctggcggtggccgatcgcgacgacacc
gatcggtcagtgccgaatatcgtgctggcgacggcgcatccggccaaatttcccgacgcg
gtcgaggccgcttgcgggcagcgtccgcagctgccggtctggctcgaaggactgatgagc
aagcgcgaggacgcaaagatcatgcggaacgagcaggccgaggtggaaaaattcatccgc
tcggtcagccgggccgccaagcagggaattgcatga

DBGET integrated database retrieval system