KEGG   Bradyrhizobium sp. ORS 278: BRADO6742Help
Entry
BRADO6742         CDS       T00516                                 

Gene name
pyrD
Definition
dihydroorotate dehydrogenase 2 (EC:1.3.3.1)
Orthology
K00254  
dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BRADO6742 (pyrD)
Enzymes [BR:bra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     BRADO6742 (pyrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7003804..7004898)
Genome map
AA seq 364 aa AA seqDB search
MIRAFDQLSLPLLRWLDAEDAHRLAIQGLKLLPAVKPRADDAKLAVRAFGLNFPNPVGMA
AGFDKNAEVPDALLRLGFGFVEIGSVTPRPQSGNPRPRLFRLERDEAVINRMGFNNDGAE
IVLRRLAGRANQGGIVGVNVGANKDSADRVADYVRLIETFAPVASYFTVNISSPNTPGLR
NLQQASQLDDLLTKVLEARDRVRRKAGDTPVLLKIAPDLSLAELDDVVHVARSRGVDGMI
VSNTTLARPNSLREQMRAKEQGGLSGRPLFRLSTRMVAETFVRVEGAFPLIGVGGIDTGG
AALTKIRAGASLIQLYSSLVYKGLGLVESIKADLTSTLLRTGRESLSEIVGADAATITAE
DWPV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcgccttcgaccagctctcgctgccgctgctccgctggctcgatgccgaggat
gcgcaccgtctcgccatccagggcctgaagctgctgcccgccgtcaagccgcgggcggac
gacgccaagctcgcggtgcgcgctttcgggctgaacttcccgaacccggtcggcatggcc
gccggcttcgacaagaacgccgaggtgccggacgccctgctgcggctcggcttcggcttc
gtcgagatcggctcggtcacgccgcgtccgcagagcggcaatccgcggccgcggctgttc
cggctggagcgcgacgaggcggtcatcaaccgcatgggcttcaacaatgacggcgccgag
atcgtgctgcgccggctcgccggtcgcgccaaccagggcggcatcgtcggcgtcaatgtc
ggggccaacaaggattccgccgaccgcgtcgccgactacgtccggctgatcgagaccttc
gcgccggtggcgagctatttcaccgtcaacatctcctcgccgaacacgcccggcctgcgc
aatctgcagcaggcgtcgcagctcgatgacttgctgaccaaggtgctggaggcgcgcgac
cgcgtccgccgcaaggccggcgacactccggtgctgctcaagatcgcgcccgatctcagc
ctcgccgagctcgacgacgtcgtccatgtcgcgcgctcgcgcggcgtcgacggcatgatc
gtgtcgaacaccacgctggcccgtccgaactcgctgcgcgagcagatgcgcgccaaggag
cagggcgggctctcgggccggccgctgttccggctgtcgacgcgcatggtcgcggagacc
ttcgtgcgcgtcgagggcgccttcccgctgatcggcgtcggcggcatcgacaccggcggc
gccgcgctgacgaaaattcgcgccggcgccagcttgatccagctgtactcctcgctggtc
tacaagggcctcggcctagtcgagagcatcaaggcggatttgacctcgaccctgctgcgc
acggggcgcgagtcgctgtccgagatcgtcggcgccgatgcggcgacgatcacggcggag
gactggccggtctag

DBGET integrated database retrieval system