KEGG   Bradyrhizobium sp. ORS 278: BRADO6795Help
Entry
BRADO6795         CDS       T00516                                 

Definition
agmatine ureohydrolase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BRADO6795
Enzymes [BR:bra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BRADO6795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7054487..7055692)
Genome map
AA seq 401 aa AA seqDB search
MSFPAMRRSRRAGLQPQRSRLRRHHPDFDKMATQGWQALEAEGKLPSNGWRKERQWALDM
GLPGSDSLTDRDIPTFARGELPHFAGINTFMKAPYVENVRDVGKYDAAVIGIPFDSGTTY
RPGTRFGPQGIRRISALYTPYNYELGVDLREQMTLCDAGDVFTIPANLEKSFDQISRGVA
HVFSSGALPIMLGGDHSIGFPCVRGIAQCTDKRIGIIHFDRHIDIQEKDLDERMHTTPWY
WATNLPNVSPTNLVQLGIGGWQVPREGVEVARKRNTNVLTIADIEKIGLEKTAEIALELA
WKDADAVYISFDVDSIDCGFVPGTGWPEPGGFLPREALKLLGLVAAEGLCGLEVVEVSPP
YDTSDITALIGVRVVVEALGSMVAHGKLGSHKHIINKPVSF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcccagccatgcggcgcagccgccgtgccggattgcagccgcagcgctcgcgc
ctgcgccggcatcatccggactttgacaagatggcgacgcaaggctggcaggcgctggag
gccgagggcaagctgccgagcaacggctggcgcaaggagcggcaatgggcgctcgacatg
ggcctgcccggctcggacagcctgaccgatcgcgacatcccgaccttcgcgcgcggtgag
ctgccgcatttcgctgggatcaacaccttcatgaaggcgccctatgtcgagaacgtccgc
gacgtcggcaaatacgacgccgccgtgatcggcatcccgttcgattccggcaccacctat
cgtcccggcacgcgcttcgggccgcagggcatccgccgcatctccgcgctctacacgccc
tacaattacgagctcggcgtcgacctgcgcgagcagatgactttgtgcgatgccggtgac
gtcttcaccatcccggcgaacctcgaaaagagcttcgaccagatcagccgcggcgtcgcg
catgtgttctcgtctggcgcgctgccgatcatgctcggcggcgaccactcgatcggcttc
ccctgcgtgcgcggcatcgcgcagtgcaccgacaagaggatcggcatcatccatttcgac
cgccacatcgacatccaggagaaggatctcgacgagcgcatgcacaccacgccctggtac
tgggcaaccaatctgccgaacgtctcgccgaccaatctggtccagctcggcatcggcggc
tggcaggtgccgcgcgagggcgtcgaggtcgcgcgcaagcgcaacaccaacgtgctgacc
atcgccgacatcgagaagatcggcctggagaagaccgccgagatcgcgctggagctggcc
tggaaggatgccgacgccgtctacatctcgttcgacgtcgattccatcgattgcggcttc
gtgcccggcaccggctggccggagcccggcggcttcctgccgcgcgaggcgctgaagctg
ctcggcctcgtcgccgccgagggcctctgcggcctcgaagtggtcgaggtctcgccgccc
tacgatacgtccgacatcaccgcgctgatcggcgtgcgcgtcgtcgtcgaggcgctgggc
tcgatggtcgcccacggcaagctcggcagccacaagcacatcatcaacaagccggtcagc
ttctga

DBGET integrated database retrieval system