KEGG   Borrelia recurrentis: BRE_468Help
Entry
BRE_468           CDS       T00769                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bre  Borrelia recurrentis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bre00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BRE_468 (recR)
DNA repair and recombination proteins [BR:bre03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BRE_468 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503601..504185
Genome map
AA seq 194 aa AA seqDB search
MIIQDLIELVSKLPGIGKKTAARMVYDILYTGKNFSRALGQILIRLHLEIQKCKNCYNFA
EEELCDICTNLNRNKGIICVVEMPQDLEVIEATKEYDGFYFVLHGHLDPLRNIGPDELNL
DKLENYIKLLKAEEVIIATEFSIEGDVTANYISNLLKDLDINVTRIASGLPAGGSISNAD
KVTTLRALRLRLKM
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgattatacaagatttaattgaattagtttctaaacttccaggtataggaaaaaaaaca
gcagcacgaatggtttatgatattttgtataccggtaaaaatttttcaagagcattggga
caaattttaattagacttcatttagagatacaaaaatgtaaaaattgttacaattttgct
gaagaagaactttgtgatatttgtacgaatttaaatagaaataaaggtataatttgcgtt
gtagaaatgcctcaagatctggaagttattgaggctactaaggaatatgatggattttat
tttgttcttcatggtcatcttgatcctttaagaaatattggaccagatgagttaaatctt
gataaattagagaattatattaaactgttaaaagcagaagaagtaattattgctactgaa
tttagtattgagggagatgtaactgcaaattatatcagtaatcttttaaaggacttagat
attaatgttacaagaatagcatctggtcttcctgctgggggtagtattagtaatgcagat
aaagtgactactcttagggcattacgtttgagacttaaaatgtga

DBGET integrated database retrieval system