KEGG   Borrelia recurrentis: BRE_58Help
Entry
BRE_58            CDS       T00769                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bre  Borrelia recurrentis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRE_58 (tpiA)
   01230 Biosynthesis of amino acids
    BRE_58 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRE_58 (tpiA)
   00051 Fructose and mannose metabolism
    BRE_58 (tpiA)
   00562 Inositol phosphate metabolism
    BRE_58 (tpiA)
Enzymes [BR:bre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BRE_58 (tpiA)
Exosome [BR:bre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BRE_58 (tpiA)
  Exosomal proteins of bladder cancer cells
   BRE_58 (tpiA)
  Exosomal proteins of melanoma cells
   BRE_58 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(62271..63035)
Genome map
AA seq 254 aa AA seqDB search
MRKVFLAGNWKMHYTSVEAADVAKQIVDGVYNINNNVVVMVTPTFTSLCKVCRVTKGTNV
LLGAQNMSYENSGARTSEIAPSMLLEFGVDYVILGHSECRTYLGENDEIINKKVLTGLKH
PFKYLILCVGETLEEREKGKTLDVVLNQVRNGLASVYESDLQRIILAYEPVWAIGTGKTA
TKEEAQEVHKAIRLEIQSLYSKSAADNIIIQYGGSVNVDNVEGLMGENDIDGALIGGSSL
KADSFLKIINKISK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggttttcttagcaggaaattggaaaatgcattatacaagtgtagaggccgca
gatgttgctaagcagattgtagatggtgtatacaatattaataataatgtggttgttatg
gtaacacctacatttacgtccctttgtaaagtttgtagagtaactaaaggaaccaatgtt
cttcttggtgctcaaaatatgtcttatgagaatagcggagctagaacaagtgaaattgcg
ccttctatgcttttggaatttggggttgattacgtaatacttggacattctgaatgtaga
acatatcttggcgaaaatgatgaaattataaataagaaagttcttacaggtcttaaacat
ccatttaaatatttaattctctgtgttggagaaactcttgaagagagagaaaaaggtaaa
actttagatgtagttttgaatcaggttagaaatggattagcatctgtatatgaatctgat
cttcagagaataattttagcttatgaacctgtatgggcaattgggacaggaaagacagca
acaaaagaagaagcacaagaagttcataaggcaattagacttgaaattcaatcgttatat
tcaaagtccgcagcagataatattattattcaatatggtggttctgttaatgttgacaat
gtggaaggtttaatgggtgaaaacgatattgatggagcattaattggtggttcatcttta
aaagcagattcgtttttaaagataattaataaaatatcgaagtag

DBGET integrated database retrieval system