KEGG   Borrelia recurrentis: BRE_626Help
Entry
BRE_626           CDS       T00769                                 

Definition
beta-glucosidase, putative (EC:3.2.1.21)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bre  Borrelia recurrentis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bre00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bre00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(665898..667553)
Genome map
AA seq 551 aa AA seqDB search
MKKIIYIIVFLINNNCFCYDFWSTENKEKLIEQIVSQMNDKELLGQMFMISYPKEKITNF
TLNFIKEKNLGGIKIFGWNAKNLYNLIESINKAQTISQKNRFKIPLFIATDQEGGWTQHI
KLKTSKTIGNLGITATLSPNDAYFTGYHIANELKQLGININFAPITDIYSNEENFIIGPR
TYSNNPQIVSLFALAFYKGQKQAGIISTAKHFPGHGNTVIDSHIKMPIINSDFKEIKRNE
LLPYKILIQENIPMIMSGHLAYPMLTNGKEIPASSSTKIIKEILRQDLKYDNLIITDDLL
MNAVRYQNESIYDTIERIIRTETDILLISLNEDIQNNAYNQLLNLMQKDNTIKENIIKSN
KRILRIKLEYLKEKRNKEELFPKYDNAKEIPTKEAEFFFEQNTLRSITKIKLSKKISKHK
KTLLISPYNTMIKEGKKIFQNSYGYYYNYYPLNSINITQLKEIKNLIAQYEQVIFNVSTP
ASLEYIKNLKEYKNKISIIVSLTPQHIKQLNWIENIVVVYGTTTLSFKSGFLTLTEDFNP
KGQIPLMNLKN
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattatttatataattgtttttttaattaataataattgtttttgttatgac
ttttggagtacagaaaataaagaaaaactaatagaacaaatagtaagtcaaatgaatgac
aaagaattattgggacaaatgtttatgataagttatccaaaagaaaaaataacaaacttt
accctaaacttcatcaaagaaaaaaatttaggtggaatcaaaatttttggatggaatgca
aaaaatttatacaacttaatagaaagtataaataaagcacaaacaatttctcaaaagaat
agatttaaaattcccttatttatagcaacagatcaagaaggtggatggacacaacatata
aaacttaaaacatcaaaaacaataggaaatcttggaatcacagcaactctatcaccaaat
gatgcctactttactggatatcatatagcaaatgaattaaaacaacttggaattaacata
aattttgccccaataacagatatttacagtaatgaagaaaacttcataataggcccaaga
acatattcaaataatccacaaatcgtatctctatttgcattggctttctataaaggacaa
aaacaagcaggcatcatctcaacagcaaaacattttcccggacatggcaatactgttatt
gattctcatataaaaatgccaataatcaattcagatttcaaagaaattaaaagaaatgaa
ttgctgccatataaaatactaatacaagaaaacattccaatgattatgagcggacactta
gcatatccaatgcttacaaacggaaaagaaatacctgcatcctcatcaactaaaattatc
aaggaaattcttaggcaagacttaaaatacgacaatttaataataacagacgacctacta
atgaatgcagtaagatatcaaaatgaaagcatttatgacacaattgaacgaattattaga
acagaaactgatattttattaatatcattaaatgaagatatacaaaataatgcttacaat
caactattaaacctcatgcaaaaagacaatacaataaaagaaaacattattaaatctaac
aaaagaatacttagaataaaattagaatatctaaaagaaaaaagaaacaaagaagaactt
ttcccaaaatatgacaatgctaaagaaatacctactaaagaagctgaatttttttttgaa
caaaatacattaagaagtataacaaaaataaaactatcaaaaaaaatatcaaagcataaa
aaaacgctattaatatcaccttataatacaatgattaaagaaggtaaaaaaatatttcaa
aatagttatggctattattataattattatccactaaatagcataaatatcacacaatta
aaagaaataaaaaatttaattgcacaatatgaacaagttatttttaatgtatcaacacct
gctagtttagagtacataaaaaatttaaaagaatataaaaataaaataagcatcattgta
tctcttaccccccaacacattaaacaactgaactggatagaaaacatagtagtagtatat
ggaactacaacactatcatttaaatctggatttttaactttaacagaagattttaatcca
aaaggacaaatacctttaatgaatctcaagaattaa

DBGET integrated database retrieval system