KEGG   Borrelia recurrentis: BRE_664Help
Entry
BRE_664           CDS       T00769                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bre  Borrelia recurrentis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRE_664 (gpmA)
   01230 Biosynthesis of amino acids
    BRE_664 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRE_664 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BRE_664 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BRE_664 (gpmA)
Enzymes [BR:bre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BRE_664 (gpmA)
Exosome [BR:bre04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BRE_664 (gpmA)
  Exosomal proteins of melanoma cells
   BRE_664 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715882..716634
Genome map
AA seq 250 aa AA seqDB search
MYKLVLVRHGESKWNKENLFTGWTDVKLSEKGVSEACEGGRILKEEGYSFDIAFSSMLVR
ANDTLNIILCELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDKVLIWRRSYNVP
PMPLDESDKRHPIHDSRYKNIPKSELPSTECLKDTVARVIPYWTDKIAKAILEGKRVIVA
AHGNSLRALVKYLDNMSEEDILKLNIPTGIPLVYELDKNLKPVKHYYLGDEDKIKAAMES
VANQGKKIDR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtataagttagttttagtgaggcatggtgagagtaaatggaataaggaaaatcttttt
acaggatggactgatgttaaactttctgagaagggtgtttctgaagcttgtgagggtggt
agaatattgaaagaggaaggttattcttttgatattgcttttagctcaatgttagtaaga
gctaatgatactttaaatattattttgtgtgaattgggtcaatcgtatattgatgtagaa
aaatcttggcgacttaatgagagacattatggggcattgcaaggattaaataaggctgaa
acggctgaaaagtatggcgaagataaagttctcatttggagacgtagttataatgttcct
cctatgcctttggatgaatctgataagcgtcatcctattcatgattcaagatataaaaat
attcctaaaagtgaacttccttcaaccgagtgtttaaaagatactgttgcaagagttata
ccatattggacagataaaattgctaaggctattcttgaaggaaaaagagttattgttgct
gctcatggtaattctttaagagcccttgttaaatatcttgataatatgagtgaagaagat
attttaaagctcaatattccaacgggtattcctttagtttatgagcttgataaaaattta
aaacccgttaaacattactatttgggtgatgaagataaaattaaggcagctatggaatct
gttgctaatcaaggtaaaaaaatagatagataa

DBGET integrated database retrieval system