KEGG   Burkholderia rhizoxinica: RBRH_00012Help
Entry
RBRH_00012        CDS       T01355                                 

Definition
NAD-dependent 4-hydroxybutyrate dehydrogenase (EC:1.1.1.61)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
brh  Burkholderia rhizoxinica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RBRH_00012
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBRH_00012
  Lipid metabolism
   00071 Fatty acid degradation
    RBRH_00012
  Amino acid metabolism
   00350 Tyrosine metabolism
    RBRH_00012
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RBRH_00012
   00626 Naphthalene degradation
    RBRH_00012
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RBRH_00012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77276..78433
Genome map
AA seq 385 aa AA seqDB search
MIPFRFQTVPTVIVEFGAARRLGTLLREHFGTLSRLCVVTDTLLHRSGLLGPALADLTAQ
GWHVTVIDDVVADPPEQVVLDAAARASAVGAEIVLGLGGGSSMDVAKLIAVLVAGQQPLA
EMYGVGNVRGTRVPLVQMPTTAGTGSEVTAVSIVTLGEARKMGVVAPQLFADVAILDAEL
TLGLPRATTAATGIDAMVHAIEAYTSARLKNPLSDRLALQALELLSRHLLPACDNGQDRA
AREAMLLGAMLAGQAFANAPVAAVHALAYPIGGLFHVPHGLSNALVLPHVLRFNANAAAQ
QYAQLAEIIAPDARGSDEARTAAWIARIDALIAATGIPRTLREVGVGRHELPRMAADAML
QTRLLVNNPREVGEADALAIYEQAW
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgatcccatttcgctttcagaccgtgccaacggtcatcgtggagttcggcgcggcacgc
cggctcggcacattgctgcgtgagcacttcggcacgctcagccggctgtgcgtggtgacc
gacacactcctgcatcgcagcgggctgctcgggcccgcgctagcggacctcactgcacag
ggctggcatgtcaccgtcatcgatgacgtggtggccgatccgcccgaacaggtggtgctc
gacgccgccgcacgcgcctcggccgtcggtgccgagatcgtgctcggactcggcggcggc
tcgtcaatggacgtggccaagctgatcgccgtcctggtggccgggcagcaaccgctggcc
gagatgtacggcgtaggcaacgtacgtggcacgcgcgtgccgctggtgcaaatgccgacc
accgcgggcaccggctcggaagtcaccgccgtgtcgatcgtcacgctcggcgaggcgcgc
aagatgggcgtggtcgcgccgcaactgttcgctgatgtcgcgattctggacgcggaactc
acgcttggcctgccgcgcgcgacgaccgcggccaccggcatcgatgccatggtgcatgcg
atcgaggcgtacacgtcggcacgcctgaagaacccactatcggacaggctcgcgctgcag
gcgctggagctgttgtcccgccacctgctgccggcgtgcgacaacgggcaggaccgcgca
gcgcgcgaggcaatgctgctcggcgcgatgctggccggacaagctttcgccaatgcgccg
gtggccgccgtacacgcgctcgcgtatccgatcggcggcctgttccacgtgccgcacggt
ttgtccaacgccctcgtgctaccccacgtgctgcgcttcaacgcgaacgcggccgcacag
cagtatgcgcagcttgccgaaatcatcgcgcccgacgcacgcggcagcgacgaagccagg
acagcggcatggattgcacggatcgatgcgctgattgctgccaccgggatcccgaggacg
ctgcgcgaagttggcgtcggccggcacgaattgccgagaatggccgccgacgcgatgctg
caaacccgcctgctcgtgaacaatcctcgcgaagttggcgaagccgacgccctcgccatc
tacgagcaggcctggtaa

DBGET integrated database retrieval system