KEGG   Burkholderia rhizoxinica: RBRH_00037Help
Entry
RBRH_00037        CDS       T01355                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
brh  Burkholderia rhizoxinica
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RBRH_00037
Enzymes [BR:brh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     RBRH_00037
Peptidases [BR:brh01002]
 Cysteine Peptidases
  Family C44
   RBRH_00037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
50073..51815
Genome map
AA seq 580 aa AA seqDB search
MALLGIAYPNTQDFLAQNRDWMLVHDQSNRIAGALWHQQDSAGQRVIRGQLGTYFYCFYG
AAFSKLNHSEIQEDDLKKIAAEGPARLMAHFWGKYLFICFDQAARKFICCSDPSSQWTLY
WSWSSRHGLLFSDTITCLHQALVENGERPAWNKAFFTTWLRTGSVQNGELPFDRINEIPV
GCAVSYTDGGKPQLLTVWDPLKHAIKGHGETPFDILKNYLNKFVSLAERPVLELSGGLES
SAVLLALRALSSAEQPLFCAHYYHADVASSNELEHARAVAQSTRACLHEVDAKILSFAPV
QSVPRVAKPHIRYCLLAFNQYFANQLEKRENTQLISGHGGDSLFLSPPPFGALADAALAW
QWRRLVRVAMDLALIRRASLVEVVTSAARSLFSADPSENISGTFDLLSTDAQHEPFDRRT
PLHPFLQQTKIRLPGKLYQLFLAFLSLDDIRAPSYPFTSRTHYPFLCQPMVEFALSTPSY
DHFEGAHNRIVLRKSVSAATGYPNLWRRNKGETSGIDLLGIRDHKNHLMALCLEGFLAKE
GYLDLKRTRAAIDNSSKGHSNYFMDLLHLYAVELFIQGWQ
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggctcttctcggcatcgcctatcctaatacgcaggattttttggcacagaaccgggac
tggatgcttgtacacgatcaatccaaccggattgcaggcgcactttggcatcaacaagat
agtgctggccagcgtgtcatacgcgggcaattgggtacgtacttctactgcttctatggc
gcagctttttcgaagctaaaccatagtgaaatccaggaagatgatctaaaaaagattgcg
gcagaaggccctgcacggttaatggcccatttctggggaaaatatttatttatctgcttt
gaccaggctgccaggaaattcatctgctgcagcgatccaagtagtcagtggactctatat
tggtcgtggtccagccgtcatggtttgctgttttcagatacaatcacgtgtttgcatcaa
gcactcgtggaaaatggcgagcgaccagcatggaataaagcgttttttacaacatggttg
cggacaggttccgtacaaaatggtgagctgccttttgatcgtatcaatgaaattccggta
ggatgcgctgtttcctataccgatggcggtaagccgcaactcttgacggtctgggaccca
ctcaaacatgcaataaagggtcacggcgagaccccatttgacattttaaaaaactatctt
aacaagtttgtctcattggccgagcggcccgttttagaactctccggggggctggaatcc
agtgccgtgctgctcgcgctgcgagcgttatcgtccgctgaacagccgctattttgcgcg
cattattaccacgccgatgtggcttcatccaacgagcttgaacatgcgcgtgctgttgcg
caaagtacgcgggcttgccttcatgaggtggatgcaaagatcttatcatttgctcccgtt
caatccgttccgcgtgtcgccaaaccgcatatcagatattgcttgctcgcgtttaatcaa
tattttgcaaaccaacttgaaaagcgggaaaacacccaacttatcagcgggcatggagga
gattccctctttctatcccctccgcctttcggtgcacttgccgatgcggcactggcatgg
caatggcggcgactcgtccgtgttgcgatggacttggcacttattcgcagagcctccttg
gttgaagtggtcacaagcgcggctcgatcgctgttttctgcggatccttctgaaaatatc
agcggtacattcgacctgctgtccacagatgcgcaacacgaaccgttcgatcgccgaacc
cctctccacccgttccttcagcaaacgaagattcgtttgcccggcaaactataccagttg
tttttggcttttttgtcgcttgacgatatccgagcgccatcctatccatttacctcccga
acgcactacccattcctctgtcaaccgatggtggagtttgcgctgtcaacgccaagctac
gatcatttcgaaggggcgcataaccgcatcgttctgaggaagtccgtctcagctgccaca
ggttacccgaacctgtggcggcgaaacaaaggcgaaacatcgggtatcgatttactgggc
atacgcgaccataaaaaccacctgatggcgctttgcctcgagggatttctagccaaagaa
ggttatctcgatttaaagcgcacacgtgccgcaattgacaatagcagcaaaggccatagt
aattattttatggaccttcttcatctatacgccgtcgagctttttatccaaggatggcaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system