KEGG   Paraburkholderia rhizoxinica: RBRH_00185Help
Entry
RBRH_00185        CDS       T01355                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC 4.2.1.20) (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RBRH_00185
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RBRH_00185
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RBRH_00185
Enzymes [BR:brh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RBRH_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2036608..2037846)
Genome map
AA seq 412 aa AA seqDB search
MGSRGVRALSDESDAMYNLPDERGHFGPYGGVFVAETLVHALAELRDAYDQYRQDPEFVA
EYARELKHFVGRPSPIYHARRWSELLGGAQIYLKREDLNHTGAHKVNNVIGQALLARRMG
KPRVIAETGAGQHGVATATIAARLGMECVVYMGAEDVRRQAANVYRMKLLGASVVPVDSG
SRTLKDALNEAMRDWVTNVENTFYIIGTVAGPHPYPLMVRDFQRVIGDECRVQMPELVGR
QPDAVIACVGGGSNAMGIFYPYIDDTAVQLIGVEAAGDGLDTGRHAASLIGGTPGVLHGN
RTYLLQDENGQIIDTHSVSAGLDYPGVGPEHAWLRDTGRAQYVGITDDEALKAFHDCCRI
EGIIPALESSHALAYAAKLAPSLARDKLLLVNLSGRGDKDMHTVAERAGIAF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgggctcgcgtggcgtgcgggccctgtctgacgagagtgacgcaatgtacaatttgcct
gatgaacgtggccacttcggcccttatggtggcgtgttcgtcgccgaaaccctagttcat
gcgctcgccgagctgcgcgacgcgtacgaccaataccggcaggatcccgagttcgtcgcc
gaatatgcgcgcgagcttaagcatttcgtcggccgtccgtcgccgatctaccacgcacgg
cgttggagcgagctgctcggcggcgcgcagatctacttgaagcgcgaggacttgaatcac
actggcgcgcacaaggtcaacaacgtgatcggtcaggcgttgctggcgcgccgcatgggc
aagccgcgcgtcatcgcggagacgggcgccggccagcacggcgtggccacggcgacaatc
gccgcgcgccttggcatggaatgtgtggtgtacatgggcgccgaggatgtgcgccggcag
gcggcgaacgtttatcggatgaagctgctgggggcgagcgtcgtgccggtcgactcgggc
tcgcgcacgctgaaggacgcgctcaacgaagcgatgcgcgactgggtcacgaatgtcgag
aacacgttctatatcatcggcaccgtggccggtccccatccatatccgctgatggtgcgt
gactttcagcgcgtgatcggcgacgagtgtcgggtgcagatgcccgagctagtcggccgc
cagccggatgcggtgattgcgtgcgtggggggcggctcgaatgcgatgggcattttctat
ccctacatcgacgacacggcggtgcaattaatcggcgtggaggcggccggcgatggactg
gacaccggccggcacgcggcatcgctgatcggcggcacgcccggcgtactgcatggcaac
cgcacctatctattgcaagacgagaacgggcagatcatcgatacgcattcggtctcggcg
gggctggactatccaggggtcgggccggagcatgcgtggctgcgcgatactggccgcgca
cagtacgtcgggattaccgatgatgaggcgctgaaggcgtttcatgactgctgccgcatc
gagggcatcattcccgcgctcgagtccagccacgcgcttgcgtatgcagcgaagcttgca
ccgagcctggcgcgcgacaagctgctgctggtgaacctgtcgggccgtggcgacaaagat
atgcatacggtggccgagcgcgccggtatcgcgttttga

DBGET integrated database retrieval system