KEGG   Burkholderia rhizoxinica: RBRH_00189Help
Entry
RBRH_00189        CDS       T01355                                 

Definition
Folylpolyglutamate synthase / dihydrofolate synthase (EC:6.3.2.17 6.3.2.12)
Orthology
K11754  
dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
brh  Burkholderia rhizoxinica
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:brh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2032609..2033955)
Genome map
AA seq 448 aa AA seqDB search
MLGTGAVMTVFATLQDWLAHLETAHPVGIDMGLARIGRVKAALGLQFNCPVITVGGTNGK
GSTCAILEAILLRAGYHVGCHTSPHLLEFNERARVDGRNAPDDELLPHFEAVEAARLSLP
EPVSLTYFEFTTLAIMRLFVSLQLDAVILEVGLGGRLDAVNIIDADCAVITSVDLDHQHY
LGDTREQIGREKAGIFRPGKPAIVGDPLPPHSVVEHAEAIGADLWLFNRDFHYEGHAGSE
RQQWSYRGRTLKRAALAYPALRGANQLLNTAAALAALEALRERLPVSAQDIRLGLANVEL
PGRFQVLPGKPAIVLDVAHNPHAAAVLAQNLGNMGYFPYTYAVFGAMADKDIAGVLARLK
GEVDHWCVTELPTTRAARALDIEQTLETLGVARGDPDAPSDASIRQFANPQLAYQDALSR
ASENDRIVVFGSFYTVAGVMAYRKMQHH
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgctcggcactggggctgtcatgactgttttcgcaacgcttcaggattggctcgcgcat
ctagaaaccgcccatccggttggcatcgacatggggttggcgcgcattggacgcgtgaag
gcggcgctcggcctgcagttcaactgcccggtgatcacggtgggcggcaccaacggcaag
ggatcgacgtgcgcgattctggaagcgattctgctgcgtgccggctatcacgtcgggtgc
cacacgtcgccacacctgctcgagttcaacgaacgtgcgcgcgtggacggccgcaatgcg
cccgatgacgaactgctgccgcatttcgaagcggtcgaggctgcacggttgtcgttgccc
gagccggtgtcgctgacctacttcgagttcacgacgctggcgatcatgcgcttgttcgta
tccctccagcttgatgcggtgattttggaggtcggcctgggcggccggctcgacgcggtg
aatatcatcgatgccgattgtgcggttatcaccagcgtcgatctggaccaccagcattac
ctgggcgacacgcgggagcagatcggccgcgagaaggcggggatctttcgtcccggcaag
ccggcgatcgtcggcgatccgctgccgccgcatagcgtggtcgagcatgccgaggcgatc
ggcgccgacctgtggctgttcaaccgcgactttcattacgagggtcatgccggcagcgag
cggcagcaatggagctaccgcggccgcacgctaaaacgcgcggcgctggcctatccggcg
ctgcgcggcgcaaaccagttgctcaataccgcggcggcgctcgctgcactcgaggcgctg
cgcgagcgtctgccggtcagcgcgcaggatatccggctcgggctggccaacgtcgagctg
cccgggcgcttccaggtgctgcccggcaaaccggcgatcgtgctggatgtcgcgcacaat
cctcacgcggccgcggtgttggcacagaatctgggcaacatgggttatttcccgtacacc
tatgcggtgttcggcgcgatggccgacaaggatatcgccggcgtgctcgcacgcttgaaa
ggcgaggtcgatcattggtgcgtgactgaattgcccacgacgcgcgcggcccgtgcgctc
gacatcgaacagacattagagacgctaggtgtggcgcgcggcgaccccgacgcgccctcg
gacgcgtcgatccggcagttcgcgaatccgcagcttgcctatcaggatgccctcagccgg
gcgtccgaaaatgatagaatcgtggttttcggcagtttctatacggtagccggcgtgatg
gcctatcgtaagatgcagcatcattga

DBGET integrated database retrieval system