KEGG   Burkholderia rhizoxinica: RBRH_00202Help
Entry
RBRH_00202        CDS       T01355                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
brh  Burkholderia rhizoxinica
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RBRH_00202
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBRH_00202
   00650 Butanoate metabolism
    RBRH_00202
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RBRH_00202
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RBRH_00202
   00622 Xylene degradation
    RBRH_00202
   00621 Dioxin degradation
    RBRH_00202
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RBRH_00202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2020021..2020983)
Genome map
AA seq 320 aa AA seqDB search
MTQKVKVAIIGSGNIGTDLMIKVMRNGKHLQMGAMVGVDPQSDGLARAARLGVATTARGI
DGLLELDVFDDVDIVFDATSAAAHARHNEILQAHGVQVIDLTPAAIGPFVIPAINLQAET
ASNINMVTCGGQATIPIVAAVSRVAKVHYAEIVASIASKSAGPGTRANIDEFTETTRRAI
ESLGGATRGKAIIVLNPAEPPLIMRDTVFVLSEHVDTQRVEQSIEQMVQSVQAYVPGYRL
KQKVQFDEIVPQRPLNVPGIGLAHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGD
LIARRRLDTGMARGHRETAQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaaaggtgaaggtcgccattatcggctcgggcaatatcggcaccgacctgatg
atcaaggtgatgcgcaacggcaagcacctacagatgggtgcgatggtgggcgtcgatccg
cagtccgacgggttggcgcgggctgcgcggctcggcgtagcgacaactgcgcggggcatc
gatggattgctcgagctggatgtgtttgacgacgtcgacatcgtgttcgacgcgacgtct
gccgccgcgcatgcgcggcacaatgagatcctgcaggcccatggcgtgcaggtgatcgac
ctgacgccagccgcgattgggccattcgtgattccggcgattaacctgcaggccgagacc
gcgtcgaacatcaatatggtcacgtgcggcggccaggcgacaataccgatcgtggcggcg
gtctcgcgcgtagctaaggttcactatgcggaaattgttgcgtcgatcgccagcaagtcc
gcgggacccggcacgcgcgcgaacatcgacgaattcaccgagaccacgcgccgcgcgatc
gagtcgttgggcggtgccacgcgcggcaaggcaatcattgtcctcaatccggcggagccg
ccgctgatcatgcgcgatacggtgtttgtgctgtccgagcacgtcgatacgcagcgggtc
gagcaaagcatcgagcaaatggtgcaaagcgtacaagcctacgtgccgggataccggctc
aaacagaaggtccaatttgatgagattgtgccgcagcgtccactgaacgtgcccggcatc
ggactcgcgcatggtctgaagacgtccgtgttcctggaggtcgaaggcgcggcgcactat
ttgccgtcgtatgccggcaatctagacatcatgacatcggccgcgcttgcatgcggcgat
ttgatcgcgcgccgccgcctcgacacgggcatggcgcgcggccatcgggagaccgcacaa
tga

DBGET integrated database retrieval system