KEGG   Paraburkholderia rhizoxinica: RBRH_00202Help
Entry
RBRH_00202        CDS       T01355                                 

Definition
(GenBank) Acetaldehyde dehydrogenase (EC 1.2.1.10)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00360  Phenylalanine metabolism
brh00362  Benzoate degradation
brh00620  Pyruvate metabolism
brh00621  Dioxin degradation
brh00622  Xylene degradation
brh00650  Butanoate metabolism
brh01100  Metabolic pathways
brh01120  Microbial metabolism in diverse environments
brh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBRH_00202
   00650 Butanoate metabolism
    RBRH_00202
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RBRH_00202
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RBRH_00202
   00622 Xylene degradation
    RBRH_00202
   00621 Dioxin degradation
    RBRH_00202
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RBRH_00202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh DapB_N F420_oxidored GFO_IDH_MocA NAD_binding_3 RNase_HII CoA_binding
Motif
Other DBs
NCBI-ProteinID: CBW75585
UniProt: E5ASK3
Position
complement(2020021..2020983)
Genome map
AA seq 320 aa AA seqDB search
MTQKVKVAIIGSGNIGTDLMIKVMRNGKHLQMGAMVGVDPQSDGLARAARLGVATTARGI
DGLLELDVFDDVDIVFDATSAAAHARHNEILQAHGVQVIDLTPAAIGPFVIPAINLQAET
ASNINMVTCGGQATIPIVAAVSRVAKVHYAEIVASIASKSAGPGTRANIDEFTETTRRAI
ESLGGATRGKAIIVLNPAEPPLIMRDTVFVLSEHVDTQRVEQSIEQMVQSVQAYVPGYRL
KQKVQFDEIVPQRPLNVPGIGLAHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGD
LIARRRLDTGMARGHRETAQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaaaggtgaaggtcgccattatcggctcgggcaatatcggcaccgacctgatg
atcaaggtgatgcgcaacggcaagcacctacagatgggtgcgatggtgggcgtcgatccg
cagtccgacgggttggcgcgggctgcgcggctcggcgtagcgacaactgcgcggggcatc
gatggattgctcgagctggatgtgtttgacgacgtcgacatcgtgttcgacgcgacgtct
gccgccgcgcatgcgcggcacaatgagatcctgcaggcccatggcgtgcaggtgatcgac
ctgacgccagccgcgattgggccattcgtgattccggcgattaacctgcaggccgagacc
gcgtcgaacatcaatatggtcacgtgcggcggccaggcgacaataccgatcgtggcggcg
gtctcgcgcgtagctaaggttcactatgcggaaattgttgcgtcgatcgccagcaagtcc
gcgggacccggcacgcgcgcgaacatcgacgaattcaccgagaccacgcgccgcgcgatc
gagtcgttgggcggtgccacgcgcggcaaggcaatcattgtcctcaatccggcggagccg
ccgctgatcatgcgcgatacggtgtttgtgctgtccgagcacgtcgatacgcagcgggtc
gagcaaagcatcgagcaaatggtgcaaagcgtacaagcctacgtgccgggataccggctc
aaacagaaggtccaatttgatgagattgtgccgcagcgtccactgaacgtgcccggcatc
ggactcgcgcatggtctgaagacgtccgtgttcctggaggtcgaaggcgcggcgcactat
ttgccgtcgtatgccggcaatctagacatcatgacatcggccgcgcttgcatgcggcgat
ttgatcgcgcgccgccgcctcgacacgggcatggcgcgcggccatcgggagaccgcacaa
tga

DBGET integrated database retrieval system