KEGG   Burkholderia rhizoxinica: RBRH_00314Help
Entry
RBRH_00314        CDS       T01355                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
brh  Burkholderia rhizoxinica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RBRH_00314
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBRH_00314
   00630 Glyoxylate and dicarboxylate metabolism
    RBRH_00314
Enzymes [BR:brh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RBRH_00314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pBRH01:413398..414993
Genome map
AA seq 531 aa AA seqDB search
MAHPTPSLPEGVQIHAPLKPGFEAILTHDALALVAQLHRQFEARRQTLLAARVERAKRLD
AGERPDFLPQTQAIREGSWTVAPLPADLQCRRVEITGPVERKMVINALNSGADSYMTDFE
DSNAPNWDNQIQGQINLKDAVRRTISLEQNGKSYRLNDKIATLLVRPRGWHLDEKHVTVD
GQRVSGALFDFALFLFHNAKEQLSRDTGPYFYLSKMESHLEARLWNDVFVAAQQAIGIPR
GTIRATVLVETILAAFEMDEILYELREHSAGLNAGRWDYIFSAIKKFKTDNDFCLADRAQ
VTMTAPFMRAYALLLVKTCHRRNAPAIGGMSALIPIKNDPATNDKALAGVRSDKARDAGD
GYDGGWVAHPGLVPIAMEEFVKVLGDKANQISKQRDDVQVTAKDLLDFRPQAPITEAGLR
NNINVGIHYLGSWLAGNGCVPIHNLMKDAATAEISRSQVWQWIRSPKGKLDDGRKVSAEL
VRALGVEELAKVKAVVGGDTAPYDRAAQIFEQMSTSDTFIDFLTLPLYEAI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcacacccgactccctcgctacccgaaggcgtgcagattcacgctccgctcaagccg
ggcttcgaagcgatcctcacgcatgacgcactcgcgttggttgcccaactccaccgtcaa
ttcgaagcgcgccgccaaaccctgttggctgcgcgcgtggagcgtgcaaagcggttagat
gccggcgaacgacccgacttcttgccccaaactcaagccattcgagagggcagctggact
gtcgcaccgctgcctgccgacctgcaatgccgtcgtgtcgagatcaccgggccggttgag
cgcaaaatggtcatcaacgcgctgaactccggcgcggactcgtacatgaccgacttcgag
gactcaaacgcgccgaactgggacaaccagatccaaggccagatcaacctgaaggacgcg
gtgcgacgcacgatctcgttggagcagaacggcaagtcataccggctcaacgacaagatc
gcgacgctgctggtgcgcccccgcggctggcacctcgacgagaagcatgtgacggtcgat
ggtcaacgcgtgtctggtgctctgttcgacttcgcgttgttcctcttccataacgccaag
gagcaactgtcgcgtgacaccggcccgtatttctatctgtcgaagatggaaagccacctg
gaagcgcggctgtggaatgatgtgttcgtcgccgcgcaacaggccatcggcatcccgcgc
ggcacgatccgcgcgaccgtgctggtcgagaccatcctcgccgcgttcgagatggacgag
atcctgtacgagctgcgtgaacacagcgccgggctgaacgccgggcgctgggactatatt
ttctcggcaatcaagaaattcaagaccgacaacgacttctgcctcgccgatcgtgcccag
gtgacgatgactgcgccgttcatgcgggcatacgcgttgctgctggtcaagacctgtcac
cggcgcaacgcaccggcgatcggtggcatgagcgcgctgattccgatcaaaaacgatccg
gctaccaacgacaaggcgttagccggcgtgcgttcggacaaggcccgagatgcgggcgat
ggctacgatggtgggtgggtcgcccaccctggtctggtgccgatcgcgatggaagagttc
gtcaaggtgctcggcgacaaggccaaccagatcagcaaacaacgcgacgacgtgcaagtc
accgccaaggatctgctcgacttccgcccgcaagcgccgattaccgaagccggcttgcgc
aacaacatcaacgtgggcatccattaccttggctcgtggctagctggcaacggctgcgtg
ccgattcacaacctgatgaaagacgcggcgaccgctgaaatctcgcgttctcaggtgtgg
cagtggatccgctcgccgaagggcaagctcgatgacggccgcaaggtgagcgcggaactc
gtgcgtgcgctgggcgtcgaggaactcgccaaggtcaaggccgtcgtgggcggcgacact
gcgccatacgaccgggccgcgcagatcttcgagcagatgtcgacatcggacacgttcatc
gactttctgacgctaccgctgtacgaagcgatttga

DBGET integrated database retrieval system