KEGG   Burkholderia rhizoxinica: RBRH_00314Help
Entry
RBRH_00314        CDS       T01355                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
brh  Burkholderia rhizoxinica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RBRH_00314
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBRH_00314
   00630 Glyoxylate and dicarboxylate metabolism
    RBRH_00314
Enzymes [BR:brh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RBRH_00314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pBRH01:413398..414993
Genome map
AA seq 531 aa AA seqDB search
MAHPTPSLPEGVQIHAPLKPGFEAILTHDALALVAQLHRQFEARRQTLLAARVERAKRLD
AGERPDFLPQTQAIREGSWTVAPLPADLQCRRVEITGPVERKMVINALNSGADSYMTDFE
DSNAPNWDNQIQGQINLKDAVRRTISLEQNGKSYRLNDKIATLLVRPRGWHLDEKHVTVD
GQRVSGALFDFALFLFHNAKEQLSRDTGPYFYLSKMESHLEARLWNDVFVAAQQAIGIPR
GTIRATVLVETILAAFEMDEILYELREHSAGLNAGRWDYIFSAIKKFKTDNDFCLADRAQ
VTMTAPFMRAYALLLVKTCHRRNAPAIGGMSALIPIKNDPATNDKALAGVRSDKARDAGD
GYDGGWVAHPGLVPIAMEEFVKVLGDKANQISKQRDDVQVTAKDLLDFRPQAPITEAGLR
NNINVGIHYLGSWLAGNGCVPIHNLMKDAATAEISRSQVWQWIRSPKGKLDDGRKVSAEL
VRALGVEELAKVKAVVGGDTAPYDRAAQIFEQMSTSDTFIDFLTLPLYEAI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcacacccgactccctcgctacccgaaggcgtgcagattcacgctccgctcaagccg
ggcttcgaagcgatcctcacgcatgacgcactcgcgttggttgcccaactccaccgtcaa
ttcgaagcgcgccgccaaaccctgttggctgcgcgcgtggagcgtgcaaagcggttagat
gccggcgaacgacccgacttcttgccccaaactcaagccattcgagagggcagctggact
gtcgcaccgctgcctgccgacctgcaatgccgtcgtgtcgagatcaccgggccggttgag
cgcaaaatggtcatcaacgcgctgaactccggcgcggactcgtacatgaccgacttcgag
gactcaaacgcgccgaactgggacaaccagatccaaggccagatcaacctgaaggacgcg
gtgcgacgcacgatctcgttggagcagaacggcaagtcataccggctcaacgacaagatc
gcgacgctgctggtgcgcccccgcggctggcacctcgacgagaagcatgtgacggtcgat
ggtcaacgcgtgtctggtgctctgttcgacttcgcgttgttcctcttccataacgccaag
gagcaactgtcgcgtgacaccggcccgtatttctatctgtcgaagatggaaagccacctg
gaagcgcggctgtggaatgatgtgttcgtcgccgcgcaacaggccatcggcatcccgcgc
ggcacgatccgcgcgaccgtgctggtcgagaccatcctcgccgcgttcgagatggacgag
atcctgtacgagctgcgtgaacacagcgccgggctgaacgccgggcgctgggactatatt
ttctcggcaatcaagaaattcaagaccgacaacgacttctgcctcgccgatcgtgcccag
gtgacgatgactgcgccgttcatgcgggcatacgcgttgctgctggtcaagacctgtcac
cggcgcaacgcaccggcgatcggtggcatgagcgcgctgattccgatcaaaaacgatccg
gctaccaacgacaaggcgttagccggcgtgcgttcggacaaggcccgagatgcgggcgat
ggctacgatggtgggtgggtcgcccaccctggtctggtgccgatcgcgatggaagagttc
gtcaaggtgctcggcgacaaggccaaccagatcagcaaacaacgcgacgacgtgcaagtc
accgccaaggatctgctcgacttccgcccgcaagcgccgattaccgaagccggcttgcgc
aacaacatcaacgtgggcatccattaccttggctcgtggctagctggcaacggctgcgtg
ccgattcacaacctgatgaaagacgcggcgaccgctgaaatctcgcgttctcaggtgtgg
cagtggatccgctcgccgaagggcaagctcgatgacggccgcaaggtgagcgcggaactc
gtgcgtgcgctgggcgtcgaggaactcgccaaggtcaaggccgtcgtgggcggcgacact
gcgccatacgaccgggccgcgcagatcttcgagcagatgtcgacatcggacacgttcatc
gactttctgacgctaccgctgtacgaagcgatttga

DBGET integrated database retrieval system