KEGG   Paraburkholderia rhizoxinica: RBRH_00314Help
Entry
RBRH_00314        CDS       T01355                                 

Definition
(GenBank) Malate synthase (EC 2.3.3.9)
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00620  Pyruvate metabolism
brh00630  Glyoxylate and dicarboxylate metabolism
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01120  Microbial metabolism in diverse environments
brh01200  Carbon metabolism
Module
brh_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBRH_00314
   00630 Glyoxylate and dicarboxylate metabolism
    RBRH_00314
Enzymes [BR:brh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RBRH_00314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: CBW76819
UniProt: E5AUP4
Position
pBRH01:413398..414993
Genome map
AA seq 531 aa AA seqDB search
MAHPTPSLPEGVQIHAPLKPGFEAILTHDALALVAQLHRQFEARRQTLLAARVERAKRLD
AGERPDFLPQTQAIREGSWTVAPLPADLQCRRVEITGPVERKMVINALNSGADSYMTDFE
DSNAPNWDNQIQGQINLKDAVRRTISLEQNGKSYRLNDKIATLLVRPRGWHLDEKHVTVD
GQRVSGALFDFALFLFHNAKEQLSRDTGPYFYLSKMESHLEARLWNDVFVAAQQAIGIPR
GTIRATVLVETILAAFEMDEILYELREHSAGLNAGRWDYIFSAIKKFKTDNDFCLADRAQ
VTMTAPFMRAYALLLVKTCHRRNAPAIGGMSALIPIKNDPATNDKALAGVRSDKARDAGD
GYDGGWVAHPGLVPIAMEEFVKVLGDKANQISKQRDDVQVTAKDLLDFRPQAPITEAGLR
NNINVGIHYLGSWLAGNGCVPIHNLMKDAATAEISRSQVWQWIRSPKGKLDDGRKVSAEL
VRALGVEELAKVKAVVGGDTAPYDRAAQIFEQMSTSDTFIDFLTLPLYEAI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcacacccgactccctcgctacccgaaggcgtgcagattcacgctccgctcaagccg
ggcttcgaagcgatcctcacgcatgacgcactcgcgttggttgcccaactccaccgtcaa
ttcgaagcgcgccgccaaaccctgttggctgcgcgcgtggagcgtgcaaagcggttagat
gccggcgaacgacccgacttcttgccccaaactcaagccattcgagagggcagctggact
gtcgcaccgctgcctgccgacctgcaatgccgtcgtgtcgagatcaccgggccggttgag
cgcaaaatggtcatcaacgcgctgaactccggcgcggactcgtacatgaccgacttcgag
gactcaaacgcgccgaactgggacaaccagatccaaggccagatcaacctgaaggacgcg
gtgcgacgcacgatctcgttggagcagaacggcaagtcataccggctcaacgacaagatc
gcgacgctgctggtgcgcccccgcggctggcacctcgacgagaagcatgtgacggtcgat
ggtcaacgcgtgtctggtgctctgttcgacttcgcgttgttcctcttccataacgccaag
gagcaactgtcgcgtgacaccggcccgtatttctatctgtcgaagatggaaagccacctg
gaagcgcggctgtggaatgatgtgttcgtcgccgcgcaacaggccatcggcatcccgcgc
ggcacgatccgcgcgaccgtgctggtcgagaccatcctcgccgcgttcgagatggacgag
atcctgtacgagctgcgtgaacacagcgccgggctgaacgccgggcgctgggactatatt
ttctcggcaatcaagaaattcaagaccgacaacgacttctgcctcgccgatcgtgcccag
gtgacgatgactgcgccgttcatgcgggcatacgcgttgctgctggtcaagacctgtcac
cggcgcaacgcaccggcgatcggtggcatgagcgcgctgattccgatcaaaaacgatccg
gctaccaacgacaaggcgttagccggcgtgcgttcggacaaggcccgagatgcgggcgat
ggctacgatggtgggtgggtcgcccaccctggtctggtgccgatcgcgatggaagagttc
gtcaaggtgctcggcgacaaggccaaccagatcagcaaacaacgcgacgacgtgcaagtc
accgccaaggatctgctcgacttccgcccgcaagcgccgattaccgaagccggcttgcgc
aacaacatcaacgtgggcatccattaccttggctcgtggctagctggcaacggctgcgtg
ccgattcacaacctgatgaaagacgcggcgaccgctgaaatctcgcgttctcaggtgtgg
cagtggatccgctcgccgaagggcaagctcgatgacggccgcaaggtgagcgcggaactc
gtgcgtgcgctgggcgtcgaggaactcgccaaggtcaaggccgtcgtgggcggcgacact
gcgccatacgaccgggccgcgcagatcttcgagcagatgtcgacatcggacacgttcatc
gactttctgacgctaccgctgtacgaagcgatttga

DBGET integrated database retrieval system