KEGG   Burkholderia rhizoxinica: RBRH_00316Help
Entry
RBRH_00316        CDS       T01355                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
brh  Burkholderia rhizoxinica
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RBRH_00316
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RBRH_00316
Enzymes [BR:brh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RBRH_00316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pBRH01:411596..412903
Genome map
AA seq 435 aa AA seqDB search
MSRQQEAQKLQVQWETNPRWKGIKRGYTAEDVIRLRGSVPVEHTLARRGAEKLWMLINEE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLARADQIQWSEGKNPGDESYIDFFAPIVADAEAGFGGVLNAFELMKAMIEAGAAGV
HFEDQLASVKKCGHMGGKVLVSTREAVAKLISARLAADVSGTPTVLVARTDAEAADLITS
DIDDNDKLFLTGERTVEGFFRTRPGLEQAISRGLAYAPYADLIWCETGKPDLEYAKKFAE
AIHKAFPGKLLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHSLNYSMF
NLAYGYARNQMSAFVELQQAEFAAAEKGFTAVKHQREVGTGYFDAVTQTIEREASTTALH
GSTEDEQFFDNKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccaacaggaagctcagaaactgcaggtccagtgggaaaccaatccacgctgg
aagggcatcaagcgcggctacaccgcagaagatgtcattcgcttgcgtggctcggtaccg
gtcgagcacacgcttgcccgacgcggcgccgagaagctgtggatgctgatcaacgaagag
ccgttcgtcaacgcgcttggcgcattgactggcaaccaggcgatgcagcaggtcaaggcc
gggttgaaggcaatctacttgtcaggctggcaagtcgcgggcgatgccaacgtcgccggc
gaaatgtatccggaccaatcgctgtacccggccaactcggtaccgctggtcgtcaagcgc
atcaacaacacgctggcccgtgctgaccagatccaatggtccgaaggcaagaatccgggt
gacgaaagctacatcgacttcttcgcaccaattgttgcggatgccgaagctggctttggc
ggcgtgctgaacgcattcgagctaatgaaggcaatgatcgaagcgggtgcggccggggta
cacttcgaggatcaactcgcctccgtcaaaaagtgcggccacatgggcggcaaggtgctg
gtgtcgacccgcgaagcggtagccaaactcatttcggcgcggctcgcggccgacgtcagc
ggcacgccgacggtattggtggcccgcaccgacgcggaagccgctgacctgattacctcc
gatatcgacgacaacgacaagctgttccttactggcgagcgcacagtcgaaggcttcttc
cgcacccgcccgggcttggagcaagcgatctcgcgcggcctggcgtacgcgccgtatgcc
gacctgatttggtgcgaaaccggcaagccggacctggaatacgcgaaaaagtttgctgag
gcaatccacaaggcattcccaggcaagctgctgtcgtacaactgctcaccgtcgttcaac
tggaaaaagaacctggacgatgcaacgatcgcaaagttccaaaaggagcttggcgcgatg
ggctacaagtttcagttcatcacgctggccggcttccacagcctaaactactcgatgttc
aaccttgcctatggctacgcgcgcaaccagatgagcgccttcgttgagttgcagcaggcc
gagttcgccgcagccgaaaagggtttcaccgcggtcaagcaccaacgtgaagtcggcacc
ggctacttcgacgcggtcacgcagacgatcgagcgcgaagcgtcgacgaccgcactgcat
ggctccaccgaagacgaacagttctttgacaataagaaggtcgcgtaa

DBGET integrated database retrieval system