KEGG   Burkholderia rhizoxinica: RBRH_00659Help
Entry
RBRH_00659        CDS       T01355                                 

Definition
Thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
brh  Burkholderia rhizoxinica
Brite
Enzymes [BR:brh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     RBRH_00659
Secretion system [BR:brh02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   RBRH_00659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pBRH02:60466..61284
Genome map
AA seq 272 aa AA seqDB search
MTARRLPRRNTGGCSNAPVPATGVIKMTKRALIFALATALAVPAFANEQAPAYIVDKFKA
MYPKTTFNEVRKSKVLGLYEVVMGENIAYTDESGRFFLFGHLFDMQEQVDLTASRQREAK
NTEFPTQHLANAIKSVKGDGSRVFAVFSDPDCPYCKQLEGELAHLDNVTIYTFLYPLESL
HPQAKTKAVSVWCAPDHGKAWSELMLAGKKPKLVACNNPVNDNLVLGSKLGVVGTPTLIA
ADGRVMLGFAPAEKLDRWLDDGKPVAQQGAVQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaaggcgcttgccaaggaggaataccgggggttgctcaaacgctccagtaccc
gcaacaggagttatcaagatgactaagcgcgcattgatttttgcgttggccaccgcgctc
gccgttcccgcttttgccaacgagcaagcgccagcgtatatcgtagacaagttcaaggcc
atgtacccaaaaacgactttcaatgaagttcgcaagtcaaaagtcttgggcctctacgaa
gtggtgatgggcgagaacattgcctacactgatgagtctggccgcttcttcctctttggg
catctgttcgacatgcaggagcaggtggacttaaccgcttcgcgccagcgcgaggccaag
aacacagagtttcccacgcaacacctagccaacgccatcaagtccgtgaaaggcgacggc
agccgtgtgttcgccgtcttcagcgaccccgattgcccatattgcaaacaactggaaggc
gagcttgcgcatctggataacgtgaccatttacaccttcctttacccattggagtccctg
cacccgcaggccaagacgaaggcggttagcgtttggtgcgcgcccgaccatggcaaggca
tggagcgaactcatgttggccggcaagaagccaaagctggtggcgtgcaacaatccggtc
aatgacaacctggtgcttggctcgaagctcggcgtagtcggtaccccgacgctgattgcc
gccgatgggcgcgtgatgcttggctttgcgccggccgaaaagcttgaccgatggctagac
gacggcaagccagtggctcagcaaggagcggtccaatga

DBGET integrated database retrieval system