KEGG   Burkholderia rhizoxinica: RBRH_00929Help
Entry
RBRH_00929        CDS       T01355                                 

Definition
acyl-CoA desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
brh  Burkholderia rhizoxinica
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:brh01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:brh01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
526572..527768
Genome map
AA seq 398 aa AA seqDB search
MLNFMLDFVAHGLLNWSWWQIVLYTLVMTHITIIGVTVYLHRHQAHRALDLHPIASHFFR
FWLWLTTGMVTGQWAAIHRKHHAKCETDEDPHSPQTRGIWKVLLEGAELYRTEAKNEQTL
KKYGHGTPDDWLERHVYAKHAVLGVTIMALIDLALFGIVGISVWAIQMVWIPFWAAGVVN
GLGHFWGYRNFNCADASTNLFPWGILIGGEELHNNHHTYATSAKLSNKWYEFDIGWMYIR
LMSACRLAKVKKIAPTPKLAARKAVPDLDTLHAVLANRYEVMARYAKTVKRAYRQELAHL
KELGAREKYALIKGAREWIHKDEAGLDEPQKRQLMQIFASSQRLRTYYQLRVELAQIWDR
SNASREQLLSHLQDWCHRAEQSGIKALQEFALRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaatttcatgcttgatttcgttgcacatggcctgctgaactggtcttggtggcaa
atcgtgctgtatacgctcgtgatgacgcacatcacgatcatcggtgtcactgtttacctg
catcggcaccaggcgcaccgcgcgttggacttgcatccgattgccagccacttcttccgc
ttctggctatggttgaccacgggcatggtcaccggccagtgggcggcgattcatcgcaag
catcatgcgaaatgcgagaccgacgaggatccgcacagtccgcagacgcgcgggatatgg
aaagtgctgctcgagggcgccgaactgtaccgcaccgaggcgaagaacgagcaaacgctg
aagaagtatgggcacggcacgccggacgattggctcgagcggcatgtctacgccaaacat
gcggtgctcggcgtgacgatcatggcgttgatcgacttggcgctgttcggcatcgttggc
atttcggtgtgggccatccagatggtgtggattccgttctgggccgctggcgtggtcaat
ggcctcggccatttctggggctaccgcaatttcaactgtgcggacgcgagcacgaacctg
ttcccatggggcatcctgattgggggggaggagctgcacaacaatcaccacacctatgcg
acgtcggcaaagttgtcgaacaagtggtacgagttcgacatcggctggatgtacatccga
ctcatgtcggcatgccgactcgcgaaggtgaagaaaattgcgccgacgccgaagctggcg
gcgcgcaaggcggtgcccgacctagacacattgcacgcggtgctggccaaccgctacgag
gtgatggcgcgctacgcgaaaacggtcaagcgggcgtaccggcaggagttggcgcacttg
aaggaattgggcgcgcgtgagaagtacgcgctgatcaagggcgcgcgcgagtggattcac
aaggatgaggccggcctggacgagccgcagaaaaggcaactgatgcagatcttcgccagc
agccagcgcctgcgcacgtattatcagttgcgggtggaactggcgcagatatgggatcgc
tcgaacgcgtcacgcgagcaattgttgtcgcacttacaggattggtgccatcgcgcggag
caaagcggcatcaaggcattgcaggagttcgcactgcgcctgcgccgctacgcgtaa

DBGET integrated database retrieval system