KEGG   Paraburkholderia rhizoxinica: RBRH_01010Help
Entry
RBRH_01010        CDS       T01355                                 

Definition
(GenBank) Guanylate kinase (EC 2.7.4.8)
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00230  Purine metabolism
brh01100  Metabolic pathways
Module
brh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RBRH_01010
Enzymes [BR:brh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RBRH_01010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 RsgA_GTPase ABC_tran AAA_16 AAA_18 AAA_29 AAA_22 AAA_23 Septin DUF3987 Dynamin_N cobW
Motif
Other DBs
NCBI-ProteinID: CBW74182
UniProt: E5ANK0
Position
626430..627113
Genome map
AA seq 227 aa AA seqDB search
MTNNRNPYAGEYPGNLFMVVAPSGAGKSTLVNALLARDPSIRLSVSYTTRPPRPNETNGV
QYHFIPASDFLERHAQGEFLESAEVHGNYYGTSRVWIEEQMRRGVDVLLEIDWQGAQQVR
KQFRNAVGIFILPPSLDALEERLRKRGQDEPNVIVRRLLAAGSEIAHAPEFEYVLINEHF
DRALTEIQTVVAATRLRFASQRARHEKLFVELGIHSSQADGSRGELK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaatcgcaatccctacgccggagaatatcccggtaacctgttcatggtggtc
gcgccgtccggcgcgggcaagtccacgttggtcaacgcgctattggcgcgcgacccgtcg
atccggctgtcggtgtcgtacaccacccggccgccgcggccgaacgagacgaacggcgtt
cagtatcatttcatcccggcgtccgacttcctcgagcgtcatgcccagggtgaatttctc
gagagtgccgaagtccatggcaattactatggtacgtcgcgcgtgtggatcgaagagcag
atgaggcgtggcgtagacgtgctgctcgaaatcgattggcagggcgcgcagcaggtgcgt
aagcagttccgaaacgcggtcggcatctttattctgccgccgtcgcttgacgcgctcgag
gagcgtctgcgcaagcgtgggcaggacgagccgaacgtgattgtgcgccggctgctggcc
gccggcagcgagatcgcgcatgcgcccgaatttgaatatgtattaatcaacgagcatttc
gatcgtgcgttgaccgaaatacagaccgtggtcgccgcgacgcggctgcgtttcgcatcg
cagcgcgcacgccacgagaagctgttcgtcgagctgggcatccactcatcgcaggcggat
ggatcgcgcggtgagttaaaatag

DBGET integrated database retrieval system