KEGG   Burkholderia rhizoxinica: RBRH_01045Help
Entry
RBRH_01045        CDS       T01355                                 

Definition
porphobilinogen deaminase (EC:2.5.1.61)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
brh  Burkholderia rhizoxinica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:brh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
597218..599914
Genome map
AA seq 898 aa AA seqDB search
MRSAPRAPICTRGWRRCATCARRWPWKPSGPCRAHSVAAARCRSPRMRSGRVMCCNCGRR
LPRPTAAAYWPRRAARRRRIRPVRWRLACTWYSSCRRRVRCKSCSNCLTRRATEPRDGGR
PIVTQASLPPTSQSAAAGDAGAPVAARPTVVITRPAGQSAELLTALAATGLDGFEFPLID
ITDATDNAPLVDGLLDLERYALAVFVSPNAVDRAFAALAAARPKASPESASPVDVPPADA
LSADASSADTPSAHASAATVPPPAFSWPTTVPVAGVGPGTVRALARHGVQPHTHRIIAPG
DAVRVALQAPVYDGGAGVSYAGEPPRRDDTPAVQVSSDSYASGDAPRYDSEALIDALATA
FAPHGLTALQGRHVLLVRGDGGRELLAETLRAHGAIVQALGAYQRRLPEPSFDAWQRVHA
LLAGQPHAWVLTSSEGVRNLEELAREHLNRDEIVALKRAPIVTPHPRIGDTARKAGFDTI
TVSGAGDQAIVGALRTVFSPITQAASFSKTQSQSAQLSMTDSKDSQPAPGGAPQAAQPAR
PAAANVPPAAPFPPYESKRRRRSVSTALAWIGAVLVLAGAGAGGYVLERKVERLQQQLIV
RQQASDAQSRDTRLKADEAASAVRQLDSQLAQLAGRVGDVQTQHQALQASLQDLAKDRDD
WTLAEVEQTISSASQQLQLTGNVGLALLALQSADTRLAASTGAQVIAVRKAIAQDIDKLK
AAPSVDLAGLAIKLDDVIAQVDALPLAGEAPAVPLKSRTGTPADVAQVAAANGEPRWKVW
WHTFAADVMAQLTGLVQVRRIDNADAMLVAPDQGYLLRENVKLRLLCARVALLSRDEKLM
KADLQAAQQALARYFDPSAQATHNARERLDQVQKGAAHIELPNLEASLNAIHQNKGRG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
ttgagatctgcgcctcgcgcgccgatctgcacccgtggctggcgccgttgtgcgacatgc
gcacggcgctggccgtggaagccgagcgggccgtgtcgcgcgcactcggtggcagctgcg
aggtgccgctcgccgcgtatgcgcagtggcagggtgatgtgctgcaactgcgggcgtcgg
ttgccacgcccgacggcagccgcgtactggccgcgcagggcagcgcggcgccgacggata
cggccggtgcgctggcgcttggcttgcacgtggtacagcagttgcaggcgcagggtgcga
tgcaaatcgtgcagcaactgcttgacgcgtcgcgcgacggagccgcgtgatggggggcgg
ccaatcgtgacgcaggcgtcgcttcctcccacgtcgcagtcggcggccgcgggcgacgcc
ggcgctcctgtcgcggcacgtccgactgtggtgattacgcgcccggcaggacagagtgct
gaactgctgaccgcgcttgccgcaactgggcttgatggcttcgagtttccgctgatcgac
attactgacgcaacggacaatgcgccgctggtcgatgggttgctcgacctcgagcgttat
gcgctggcggtattcgtctcgccaaacgcggtggatcgcgcattcgcggcgcttgccgcc
gcgcggccgaaggcatcgccggaaagcgcatccccagtggacgtaccgcccgcggatgca
ttgtcggcggacgcctcgtcagccgatacgccgtcggcgcatgcgtcggccgccaccgtg
ccgccgcccgctttctcgtggccgaccacggtaccggtcgctggcgtgggtccaggcacg
gtgcgggcgttggcgcgccacggcgtgcagccgcacacgcatcgaatcatcgcacccggc
gatgcggtgcgcgtcgcgctgcaggcgccggtgtacgacggtggcgcgggtgtttcctat
gctggcgagccgccgcggcgcgacgatacccctgcggtgcaggtctcgtccgactcgtat
gcgagcggcgatgcgccgcgctacgattccgaggcgttgatcgacgcgcttgccaccgcc
tttgcgccgcacgggctcaccgcgttgcaagggcggcacgtgttgctggtgcgcggcgac
ggcggccgcgagttgctcgccgagacgctgcgtgcgcatggcgcgatcgtccaggcgctc
ggtgcgtaccagcgacggctgcccgaaccgagctttgacgcgtggcaacgcgtgcacgcg
ctgcttgccggccagccgcacgcctgggtattgaccagttcggaaggcgtgcgcaacctg
gaggagctggcgcgcgagcatctgaatcgcgacgagattgtcgcgctcaagcgcgccccg
attgtcacaccccatccgcgcatcggcgatacggcgcgcaaagcgggttttgatacgatt
acggtgtccggtgccggcgatcaagcgatcgtcggcgcgctgcgcacggtgttttcaccg
atcactcaagccgcttccttctcgaagactcaatcgcaatcggctcaattaagcatgaca
gattctaaagattcccagccagcgccaggtggggcgccgcaagcagcgcaaccggcgcgc
cctgccgcggccaacgtcccaccggctgcaccctttcccccgtacgaatcgaagcgccgc
cgccgctcagtcagcacggcgctcgcctggatcggcgcggtgttggtgctggcgggcgca
ggcgcaggcggctacgtgctcgaacgcaaggtcgagcggctgcagcagcaacttatcgtg
cgccagcaggccagcgacgcgcaaagccgcgacactcggctcaaggccgacgaggccgcg
agcgcggtacgccaactcgattcgcagctggcccaactcgccggccgggtcggcgacgtg
cagacgcagcatcaggccctgcaggcgtcgttgcaggacttggcaaaggaccgcgacgat
tggacgctggccgaagtcgagcagacaatttcgtctgctagccagcaactgcaattaacc
ggcaatgtcggcttggcgttgttggcgttgcaaagcgcggacacgcggctcgcggcatca
acgggcgcgcaggtcatcgcggtgcgcaaggcgatcgcgcaggatatcgacaagctgaag
gctgcgccaagcgtcgacctggcgggactcgcgatcaagctcgacgatgtgatcgcgcag
gtggacgccttgccgttggccggcgaggcgccggctgtgccgctcaagtcgcgtaccggc
acgccggcggacgtggcgcaggtggccgctgccaatggcgagccgcgctggaaggtatgg
tggcatacattcgcggccgacgtcatggcgcaactcaccggtctcgtacaggtgcgccgc
atcgacaacgcggacgcgatgctggtcgcgccagaccagggctatctgttgcgtgagaat
gtgaagctgcggctgctgtgcgcgcgcgtcgcgctgctctcgcgcgacgagaagctgatg
aaggcggacttgcaggccgcgcagcaggcgctcgcgcggtactttgatccgtcggcacag
gccacgcataacgcgcgtgagcggctcgatcaggttcaaaaaggtgcggcgcacatcgag
ttgccgaacctggaggcgagtttgaatgccatccatcagaacaagggccgaggctga

DBGET integrated database retrieval system