KEGG   Paraburkholderia rhizoxinica: RBRH_01060Help
Entry
RBRH_01060        CDS       T01355                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00040  Pentose and glucuronate interconversions
brh00052  Galactose metabolism
brh00500  Starch and sucrose metabolism
brh00520  Amino sugar and nucleotide sugar metabolism
brh01100  Metabolic pathways
brh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RBRH_01060
   00052 Galactose metabolism
    RBRH_01060
   00500 Starch and sucrose metabolism
    RBRH_01060
   00520 Amino sugar and nucleotide sugar metabolism
    RBRH_01060
Enzymes [BR:brh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RBRH_01060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: CBW74417
UniProt: E5AP85
Position
complement(839487..840368)
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKDKLLELVRGIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVGDNPFAVILADDLLYGRPPVMKQMIDVFDHYHSSVIGIEEVPHEETKSYGIVDGKEWE
DNIVKMSGIVEKPAPEVAPSNFGVVGRYVLKPRIFSHLRALKPGAGGELQLTDAIQSLLG
DEQVLAYKYHGTRFDCGSKLGYLKATIEFALQHPEVRDEFAEYLRTRSPVLEG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagttactaaggcagtgtttcccgtggcaggtcttggcacgcggttcctccca
gccaccaaggcgagcccgaaagaaatgcttccagtggtcgacaagccgctgattcagtat
gcggttgaggaagcgattgccgcaggtatcaccgaaatgattttcgtgacaggccgcagc
aagcgcgcgattgaggatcactttgacaagtcgtatgagatcgaagcggaactcgaggct
cgcggcaaggacaagttgctcgagctagtgcgcggaatcaagcccagccacgttgactgc
ttctacgttcgccagcccgaggcgctcgggctcgggcatgcggtgctgtgcgcagaaaaa
ctcgtcggcgataacccgttcgcggtcatcctcgccgacgatctgctgtacggtcgcccg
cccgtgatgaagcaaatgatcgacgtattcgatcactaccacagctcggtgatcggcatc
gaggaagtgccgcacgaggaaacgaagtcgtacggcatcgtcgacggcaaggaatgggaa
gacaacatcgtcaagatgtcaggcatcgtcgagaagccagccccggaggtcgcgccatcc
aattttggcgtggtcggccgctatgtgctcaagccgcgcatcttcagtcacttgcgtgca
ctgaagccaggcgcgggcggtgaattgcaattgaccgatgcgatccagtcgctgctcggc
gacgagcaggtgctcgcgtacaagtaccacggcacgcgcttcgactgcggcagcaagctc
ggctacctaaaggcaacaatcgagttcgcgctgcagcacccggaggttcgcgacgagttc
gccgaatacctacgcacccgctcgccggtactcgaaggctaa

DBGET integrated database retrieval system