KEGG   Burkholderia rhizoxinica: RBRH_01099Help
Entry
RBRH_01099        CDS       T01355                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
brh  Burkholderia rhizoxinica
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RBRH_01099
Enzymes [BR:brh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RBRH_01099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
805817..806746
Genome map
AA seq 309 aa AA seqDB search
MSFSSTEYCCSMSSTPSATGLVAGATLQCGRFRLTLARPLVMGILNVTPDSFSDGGRFIG
YEAAQARAQQMIDEGADLIDIGGESTRPGAPPLPLDEELARVLPLIDALRDTGVPISIDT
YKPEVMRAALDAGADLINDIWGLRQPGALDAVRDTRCGLCVMHMQGEPGTMQREPQYRDV
VADVRDFLDGRIRSLERAGIAADRLCVDPGFGFGKTAEHNFTLLRELPHAVPAGVPILVG
LSRKSMIGAATGRSVPQQRIAGSLAGMLAAVDRGAAIVRVHDVAPTVDALKVWQAMRARP
WCDAQSVHS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgtcattttcttctactgagtattgctgttcaatgtcgagcactcctagcgcaaccggc
ctggtcgccggcgcgacgttgcaatgcggccgcttcaggctgacgctggcgcggccccta
gtgatgggcattttgaatgtgacgccagactcgttctccgatggcggacgtttcatcggc
tacgaggccgcgcaggcgcgcgctcagcagatgattgacgagggggccgacctgatcgac
atcggcggcgaatcgacgcggcccggtgcaccgccgctcccactggacgaggagctggcg
cgggtgttgcctttgatcgacgcgttgcgtgatacgggcgtgccgatctcgatcgatacg
tacaagcccgaggtgatgcgtgccgcgctcgacgccggcgcggacttgatcaacgatatc
tggggcctgcgtcagcccggcgcgctcgatgcggtgcgcgacacgcgttgcgggctgtgt
gtgatgcatatgcaaggcgagccgggtacgatgcagcgcgagccgcagtaccgcgatgtc
gtcgcggatgttcgcgactttctcgacgggcggatccggtcactggagcgcgccgggatt
gccgcggaccggctctgtgtcgatccgggctttggttttggcaagacggccgagcacaat
ttcacactgctgcgtgaattgccgcacgccgtgcccgctggtgtgccgatccttgtgggg
ctgtcgcgtaagtcaatgatcggcgcggccacaggtcgcagcgtgccgcagcagcgcata
gccggcagtcttgccggcatgctggcggcggtcgatcggggcgcggcgattgtgcgcgtg
cacgacgtcgcgccgacggtcgatgcattgaaagtctggcaggcgatgcgggcacgaccg
tggtgcgacgcccagtccgtgcacagctag

DBGET integrated database retrieval system