KEGG   Burkholderia rhizoxinica: RBRH_01189Help
Entry
RBRH_01189        CDS       T01355                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
brh  Burkholderia rhizoxinica
Brite
Enzymes [BR:brh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     RBRH_01189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
884597..885022
Genome map
AA seq 141 aa AA seqDB search
MTKTFNMSTLLSVLSRDEGRRLKPYLDTAGKTTIGVGRNLTDVGISEGECSLLLENDVMR
SIMWLDRHLPWWRSLDAVRQRVIINMAFNMGRKLLTFANTLAAMQRGDYEAAANGMLASK
WATQVGARAQRLASMMRTGAS
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaacattcaatatgtcaacccttttgtcggtactgagtcgagacgaagggcgg
cgtttgaaaccctacttggatacggcgggcaaaaccaccattggtgtcggacgtaattta
acagatgtcggaatcagtgaaggtgaatgcagtctactactggaaaatgatgtgatgcgt
tcgataatgtggctcgatcgccacctgccgtggtggcgcagtctcgatgcggtacgccag
cgcgtcatcatcaatatggctttcaacatgggccgcaagctgctcacgtttgcgaacacg
ctggctgcgatgcagcgcggtgattatgaagcggcggccaacggcatgcttgcctcgaag
tgggccacgcaagtgggcgctcgcgcacaacgtctggcgagcatgatgcgtaccggagca
agttga

DBGET integrated database retrieval system