KEGG   Paraburkholderia rhizoxinica: RBRH_01238Help
Entry
RBRH_01238        CDS       T01355                                 

Definition
(GenBank) Succinyl-CoA synthetase beta chain (EC 6.2.1.5) (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RBRH_01238
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBRH_01238
   00640 Propanoate metabolism
    RBRH_01238
   00660 C5-Branched dibasic acid metabolism
    RBRH_01238
Enzymes [BR:brh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RBRH_01238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2347962..2348666)
Genome map
AA seq 234 aa AA seqDB search
MQDAEADEIAKKIGVPEASLAQARANLHGLYKAFWETDASLAEINPLILTGDGKVIALDA
KFNFDSNALFRHSEIVAYRDLDEEDPAEIEASKFDLAYISLDGNIGCLVNGAGLAMATMD
TIKLFGGEPANFLDVGGGATTEKVTEAFKLMLKNPNLKAILVNIFGGIMRCDVIAEGVIA
ASKAVHLQVPLVVRMKGTNEDLGKKMLADSGLPIISADSMEEAAQKVVAAAEGK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggacgctgaagcagacgagatcgccaaaaaaatcggcgtgccggaggcatcgctc
gcgcaggcccgtgcgaacctgcatggactgtacaaggcattctgggaaacggacgcatcg
ctggccgaaatcaacccgttgatcctgaccggcgacggcaaggtaatcgcgttggacgca
aagttcaacttcgattcgaacgcgctgttccgtcactcggagatcgttgcctaccgcgac
ctcgacgaagaggatccggccgaaatcgaggcatcgaagtttgatctcgcctacatctcc
cttgatggcaacatcggctgtctggtcaatggtgccggcttggcgatggcgacgatggat
acgatcaagttgttcggtggcgaaccggcgaacttcctcgatgtcggcggtggtgcgacg
accgagaaagtgaccgaagcgttcaagctgatgctgaagaacccgaacctgaaggccatc
cttgtgaacatcttcggtgggatcatgcgttgcgatgtgatcgccgagggcgtgatcgcg
gcatcgaaggcggtgcacctgcaagttccgctggtcgtgcggatgaagggtaccaacgag
gacctcggcaagaagatgctcgccgactccgggttgccaattatttccgcggacagcatg
gaagaagccgcgcagaaggtcgtcgccgcagccgaaggcaagtaa

DBGET integrated database retrieval system