KEGG   Paraburkholderia rhizoxinica: RBRH_01238Help
Entry
RBRH_01238        CDS       T01355                                 

Definition
(GenBank) Succinyl-CoA synthetase beta chain (EC 6.2.1.5)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00020  Citrate cycle (TCA cycle)
brh00640  Propanoate metabolism
brh00660  C5-Branched dibasic acid metabolism
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01120  Microbial metabolism in diverse environments
brh01130  Biosynthesis of antibiotics
brh01200  Carbon metabolism
Module
brh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
brh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBRH_01238
   00640 Propanoate metabolism
    RBRH_01238
   00660 C5-Branched dibasic acid metabolism
    RBRH_01238
Enzymes [BR:brh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RBRH_01238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ligase_CoA ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: CBW75954
UniProt: E5AKZ7
Position
complement(2347962..2348666)
Genome map
AA seq 234 aa AA seqDB search
MQDAEADEIAKKIGVPEASLAQARANLHGLYKAFWETDASLAEINPLILTGDGKVIALDA
KFNFDSNALFRHSEIVAYRDLDEEDPAEIEASKFDLAYISLDGNIGCLVNGAGLAMATMD
TIKLFGGEPANFLDVGGGATTEKVTEAFKLMLKNPNLKAILVNIFGGIMRCDVIAEGVIA
ASKAVHLQVPLVVRMKGTNEDLGKKMLADSGLPIISADSMEEAAQKVVAAAEGK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggacgctgaagcagacgagatcgccaaaaaaatcggcgtgccggaggcatcgctc
gcgcaggcccgtgcgaacctgcatggactgtacaaggcattctgggaaacggacgcatcg
ctggccgaaatcaacccgttgatcctgaccggcgacggcaaggtaatcgcgttggacgca
aagttcaacttcgattcgaacgcgctgttccgtcactcggagatcgttgcctaccgcgac
ctcgacgaagaggatccggccgaaatcgaggcatcgaagtttgatctcgcctacatctcc
cttgatggcaacatcggctgtctggtcaatggtgccggcttggcgatggcgacgatggat
acgatcaagttgttcggtggcgaaccggcgaacttcctcgatgtcggcggtggtgcgacg
accgagaaagtgaccgaagcgttcaagctgatgctgaagaacccgaacctgaaggccatc
cttgtgaacatcttcggtgggatcatgcgttgcgatgtgatcgccgagggcgtgatcgcg
gcatcgaaggcggtgcacctgcaagttccgctggtcgtgcggatgaagggtaccaacgag
gacctcggcaagaagatgctcgccgactccgggttgccaattatttccgcggacagcatg
gaagaagccgcgcagaaggtcgtcgccgcagccgaaggcaagtaa

DBGET integrated database retrieval system