KEGG   Paraburkholderia rhizoxinica: RBRH_01407Help
Entry
RBRH_01407        CDS       T01355                                 

Definition
(GenBank) Glucokinase (EC 2.7.1.2) / Transcriptional regulator, RpiR family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00010  Glycolysis / Gluconeogenesis
brh00052  Galactose metabolism
brh00500  Starch and sucrose metabolism
brh00520  Amino sugar and nucleotide sugar metabolism
brh00521  Streptomycin biosynthesis
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01120  Microbial metabolism in diverse environments
brh01130  Biosynthesis of antibiotics
brh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBRH_01407
   00052 Galactose metabolism
    RBRH_01407
   00500 Starch and sucrose metabolism
    RBRH_01407
   00520 Amino sugar and nucleotide sugar metabolism
    RBRH_01407
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RBRH_01407
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RBRH_01407
Enzymes [BR:brh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RBRH_01407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK
Motif
Other DBs
NCBI-ProteinID: CBW75813
UniProt: E5ATD9
Position
complement(2222072..2224636)
Genome map
AA seq 854 aa AA seqDB search
MTRARSKTRCRRRSATRCSRRWPRISARAVPRSRCRAAPARDRFCRLCRDARSTGRASTL
PWSTIAGSRRCMPTAMRDSCATRCCSTRRARPCSGRWSTSIKRPLPTSRHSTRMLRARCP
TWPCSAWEKMATRRRSSPTRRSGSWPHKPASAMCWSSRGRRRICGSACRCRRSGKSAGCF
CWSPGSASWMCCALRSSIHSTTPSPSWPTIRESTSMPTGAPKAVLARQSPHSDGPRLLAD
IGGTNARFALEFGPGQIDGIRVYSCADYPGIAAAIRKFLKDSGVGRVNHAAIAIANPVDG
DQVQMTNHNWSFSIEATRRALGFDTLLVVNDFTALAMALPSLSDAQRAQIGGGVRRQNSV
IGLLGPGTGLGVSGLIPANERWIALGSEGGHATFSPQDEREDRVLHYARKKWPHVSFERV
CAGPGLALIYRALAERDNKRLDTPLEPADVVRRAQAAEPLALEAVECFCAVLGTFAGNIA
VTLGALGGVYIGGGVIPHLGELFSTSPFRARFEAKGRFQAYLANIPTFVITAQYPALLGV
SAILAEQLGHHAGGGSAAFERIRQMRDVLTPAERRVADLALNHPRSIINDPIIDIARKAE
VSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTNPVSHSQVHLGDSATDFGAKVLDNTVSA
ILQLREQMNFDNVERAIDMLNSARRIEFYGLGNSNIVAQDAHYKFFRFGIPTIAYGDLYM
QAASAALLGKGDVIVAVSKSGKAPELLRTLEVAMQAGAQVIAITSSNTPLAKRASVALET
DPIEIRDAQLSMISRVLHLLVIDILAVGVAIRRALPDAGMQQVVEAVRGHADEDCAAVLD
WLSHGAALERRDTQ
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgcgcgcagcaagacgcgctgtcgcaggcggtcggcgacgcgctgcagtcgt
cgctggccgcgcatatcggcgcgggccgtgccacgctcgcggtgtcgggcggcaccagcc
cgcgaccgtttttgcagactttgtcgcgacgcccgctcgactgggcgcgcatcgacgtta
ccctggtcgacgatcgctgggtcccgccgatgcatgccgacagcaatgcgcgactcgtgc
gcgacacgttgctgcagcacgcggcgcgccaggccgtgttccggtcgctggtcgacgtcg
atcaagcgcccgctgcccacgtcgcggcactcaacgcggatgcttcgcgcgcgctgcccg
acgtggccgtgctcggcatgggagaagatggccacacggcgtcgatcttcgccgacgcgc
cgcagtgggagctggccacacaaacccgcgagcgctatgtgctggtcgagccgcggcagg
cgccgcatctgcgggtcagcttgtcgctgtcggcgctcaggcaaatcggccggttgtttc
tgttggtctccgggcagcgcaagctggatgtgctgcgcgctgcgatcgagcatccacagc
acaacgccatctccaagctggccaacgatacgggagtcaacgtcgatgcctactggtgcg
cctaaagcggtgctcgcgcgccagagtccacattcggatggcccgcggctgcttgccgac
ataggtggcaccaatgcgcgcttcgcactggaattcggaccgggacagattgacggtatc
cgtgtgtattcttgcgcggattatccgggcatcgctgcggcgatccgcaagttcttgaag
gacagcggggtcggtcgcgtgaaccacgcggccattgcgattgccaatcccgtcgatggc
gatcaggtgcagatgaccaaccacaactggagtttttcaatcgaggccacgcgtcgcgcg
ttaggtttcgatacgctgttggtggtcaacgactttaccgcgttggccatggcgctgccg
agcctgtctgatgcgcaacgcgcgcagattggcggcggcgtgcgccggcagaacagtgtg
atcgggctgctcggacctggcacggggttgggcgtgtcaggcttgattcccgcaaacgag
cgctggatcgcgctgggcagtgagggcgggcatgccaccttctcgccgcaggacgagcgc
gaggatcgggtgctgcactatgcgcgcaagaagtggccgcatgtgtcgttcgagcgggtt
tgcgcaggaccgggactggcactgatctaccgcgcgctggccgagcgcgacaacaagcgg
ctggacacgccgctcgagccggccgacgtggtgcggcgcgcgcaggcggccgagccgctc
gcgttggaggcagtggagtgcttctgtgcggtgcttggcacgtttgctggcaatattgca
gtcacactcggcgcgctgggcggcgtttatatcggcggcggcgtcatcccccatctgggc
gagttgttttcgacttcgccgtttcgtgcacggttcgaggcgaagggccgtttccaggcg
tacttggcgaatatcccaaccttcgtgatcaccgcgcaatatccggccttgctcggcgtg
tccgcgatcctggccgagcagctcgggcatcacgccggcggcggatcagccgcgttcgag
cgcatccggcagatgcgcgacgtgctcacgccagccgagcggcgcgtggctgatctggcg
ttgaaccacccgcgctcgatcatcaacgatccgatcatcgacatcgcgcgcaaggccgag
gtgagccagccgaccgtaatccgcttctgccgctcgcttggctgccaaggattgtccgac
ttcaagctgaagctggccaccggcctgactggcacgaacccggtgagccacagccaggtc
cacctgggcgactcggcgactgactttggcgcgaaggtgctcgacaacaccgtgtcggcc
atcctgcagctgcgcgagcagatgaacttcgataacgtcgagcgcgcgatcgacatgctg
aacagcgcacggcgcatcgaattctacggcctgggcaattcgaacatcgtcgctcaggat
gcgcactacaagttcttccgcttcgggatcccgaccattgcatacggtgacctgtacatg
caggccgcgtccgccgcgttgctgggcaagggcgatgtgattgtcgccgtctccaagtcc
ggcaaggcgccggagttgctgcgcacgctggaggtggcgatgcaagctggtgcgcaagtg
attgcaatcacgtcgagcaacacgccgctggccaagcgcgcgagcgtcgcgctggagacg
gaccctatcgagatccgcgacgcgcagctgtcgatgatctcgcgtgtgctgcacttgttg
gtaatcgacatattggcggtcggcgtcgcgatccggcgcgcgttacccgacgcgggcatg
cagcaggtggtcgaggcggtacgtgggcatgccgacgaagactgcgccgcggtgctggac
tggctcagccacggcgcggcattggaacggcgcgatacgcaataa

DBGET integrated database retrieval system