KEGG   Burkholderia rhizoxinica: RBRH_01444Help
Entry
RBRH_01444        CDS       T01355                                 

Gene name
manB
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
brh  Burkholderia rhizoxinica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBRH_01444 (manB)
   00030 Pentose phosphate pathway
    RBRH_01444 (manB)
   00051 Fructose and mannose metabolism
    RBRH_01444 (manB)
   00052 Galactose metabolism
    RBRH_01444 (manB)
   00500 Starch and sucrose metabolism
    RBRH_01444 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    RBRH_01444 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    RBRH_01444 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RBRH_01444 (manB)
Enzymes [BR:brh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RBRH_01444 (manB)
    5.4.2.8  phosphomannomutase
     RBRH_01444 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2253630..2255012)
Genome map
AA seq 460 aa AA seqDB search
MISQSIFKAYDIRGVIGKTLDADVARQIGRAFGSEVRAQGGDAVVIGRDGRLSGPQLSAA
LVDGLRAAGVDVIDIGLVPTPLGYFAASVPLAGRQVDSCIVVTGSHNPPDYNGFKMVLRG
AAIYGEQIQALYKRIVEGNFATGAGSYSEHDVRDAYVERIVSDIKPARPLKIVVDAGNGV
AGSLAPRLFKALGCELVELFCEVDGNFPNHHPDPAHPENLQDVIRALKETDAEIGFAFDG
DGDRLGVVTKDGQIIYPDRQLMLFAQEVLSRNPGGQIIYDVKCTRNLAKWVREQGGEPVM
WKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILSRVADPSQLL
NSLPNSISTPELQLKLNEGENFELIGKLQKHATFDGADDVITIDGLRVEYPDGFGLARSS
NTTPVVVMRFEADNDAALKRIQEDFRRVIIAQKPDAKLPF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgatttctcaatcgattttcaaggcttacgacattcgtggcgtcatcggcaagacgctt
gatgccgatgtggcgcggcagatcggccgcgcattcggcagcgaagtgcgtgcgcaaggt
ggcgatgcggtggtgatcggtcgcgacgggcgcctgtcgggtccgcagttgtccgccgcg
ctggtcgatggcctgcgcgcggcgggcgtggacgtgatcgatatcggcttggtgccgacg
ccgctcggctatttcgcggccagcgtgccgctcgcagggcggcaggtggattcgtgcatc
gttgtcacgggcagccataatccgccggactacaacggcttcaagatggtgttgcgcggc
gccgcgatctacggcgagcagattcaagcgttgtataagcgcatcgtcgagggcaatttc
gccacgggcgccggcagctacagcgaacatgacgtgcgcgatgcctacgtcgagcggatc
gtgtccgacatcaagccggctcggccgctgaagatcgtcgtcgatgcaggcaatggcgtg
gcgggatcgcttgcgccaaggctgttcaaggcgctcggatgcgagctggttgagctgttc
tgcgaggtggatggcaatttcccgaaccatcacccggacccggcccatcccgaaaacctg
caggacgtgattcgtgcgctgaaggagaccgacgcggagatcggctttgcgttcgacggc
gacggcgatcggctcggtgtcgtgaccaaggacggccagatcatctatccggatcggcaa
ttgatgttgttcgcgcaagaggtgctgtcgcgcaacccgggggggcagatcatctatgat
gtgaagtgcacgcgtaacttggccaagtgggtacgcgagcagggcggcgagccggtgatg
tggaagactggccactcgctggtgaaggcgaagctgcgcgaaaccggcgcgccgctcgcc
ggagagatgagcgggcacgtgttttttaaggaccgctggtacggtttcgacgacggtctc
tataccggtgcacggctgctggaaatcctgtcgcgtgtggctgatccgagtcaattgctt
aacagcttgccgaactcaatctcgacgcccgaattgcagctcaagcttaacgagggcgaa
aacttcgagctgatcggcaagctgcaaaagcatgcgacgttcgacggcgccgatgacgtg
atcacgatcgatggcctgcgcgtggagtacccagatggtttcgggctcgcacgctcatcc
aataccacgcctgtggttgtgatgcgctttgaggctgacaatgatgccgcgctcaagcgg
atccaggaggactttaggcgtgtgatcattgcgcagaagccggacgcaaaactcccgttc
tag

DBGET integrated database retrieval system