KEGG   Paraburkholderia rhizoxinica: RBRH_01444Help
Entry
RBRH_01444        CDS       T01355                                 

Gene name
manB
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00010  Glycolysis / Gluconeogenesis
brh00030  Pentose phosphate pathway
brh00051  Fructose and mannose metabolism
brh00052  Galactose metabolism
brh00230  Purine metabolism
brh00500  Starch and sucrose metabolism
brh00520  Amino sugar and nucleotide sugar metabolism
brh00521  Streptomycin biosynthesis
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01120  Microbial metabolism in diverse environments
brh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBRH_01444 (manB)
   00030 Pentose phosphate pathway
    RBRH_01444 (manB)
   00051 Fructose and mannose metabolism
    RBRH_01444 (manB)
   00052 Galactose metabolism
    RBRH_01444 (manB)
   00500 Starch and sucrose metabolism
    RBRH_01444 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    RBRH_01444 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    RBRH_01444 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RBRH_01444 (manB)
Enzymes [BR:brh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RBRH_01444 (manB)
    5.4.2.8  phosphomannomutase
     RBRH_01444 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV OMPdecase
Motif
Other DBs
NCBI-ProteinID: CBW75852
UniProt: E5ATH8
Position
complement(2253630..2255012)
Genome map
AA seq 460 aa AA seqDB search
MISQSIFKAYDIRGVIGKTLDADVARQIGRAFGSEVRAQGGDAVVIGRDGRLSGPQLSAA
LVDGLRAAGVDVIDIGLVPTPLGYFAASVPLAGRQVDSCIVVTGSHNPPDYNGFKMVLRG
AAIYGEQIQALYKRIVEGNFATGAGSYSEHDVRDAYVERIVSDIKPARPLKIVVDAGNGV
AGSLAPRLFKALGCELVELFCEVDGNFPNHHPDPAHPENLQDVIRALKETDAEIGFAFDG
DGDRLGVVTKDGQIIYPDRQLMLFAQEVLSRNPGGQIIYDVKCTRNLAKWVREQGGEPVM
WKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILSRVADPSQLL
NSLPNSISTPELQLKLNEGENFELIGKLQKHATFDGADDVITIDGLRVEYPDGFGLARSS
NTTPVVVMRFEADNDAALKRIQEDFRRVIIAQKPDAKLPF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgatttctcaatcgattttcaaggcttacgacattcgtggcgtcatcggcaagacgctt
gatgccgatgtggcgcggcagatcggccgcgcattcggcagcgaagtgcgtgcgcaaggt
ggcgatgcggtggtgatcggtcgcgacgggcgcctgtcgggtccgcagttgtccgccgcg
ctggtcgatggcctgcgcgcggcgggcgtggacgtgatcgatatcggcttggtgccgacg
ccgctcggctatttcgcggccagcgtgccgctcgcagggcggcaggtggattcgtgcatc
gttgtcacgggcagccataatccgccggactacaacggcttcaagatggtgttgcgcggc
gccgcgatctacggcgagcagattcaagcgttgtataagcgcatcgtcgagggcaatttc
gccacgggcgccggcagctacagcgaacatgacgtgcgcgatgcctacgtcgagcggatc
gtgtccgacatcaagccggctcggccgctgaagatcgtcgtcgatgcaggcaatggcgtg
gcgggatcgcttgcgccaaggctgttcaaggcgctcggatgcgagctggttgagctgttc
tgcgaggtggatggcaatttcccgaaccatcacccggacccggcccatcccgaaaacctg
caggacgtgattcgtgcgctgaaggagaccgacgcggagatcggctttgcgttcgacggc
gacggcgatcggctcggtgtcgtgaccaaggacggccagatcatctatccggatcggcaa
ttgatgttgttcgcgcaagaggtgctgtcgcgcaacccgggggggcagatcatctatgat
gtgaagtgcacgcgtaacttggccaagtgggtacgcgagcagggcggcgagccggtgatg
tggaagactggccactcgctggtgaaggcgaagctgcgcgaaaccggcgcgccgctcgcc
ggagagatgagcgggcacgtgttttttaaggaccgctggtacggtttcgacgacggtctc
tataccggtgcacggctgctggaaatcctgtcgcgtgtggctgatccgagtcaattgctt
aacagcttgccgaactcaatctcgacgcccgaattgcagctcaagcttaacgagggcgaa
aacttcgagctgatcggcaagctgcaaaagcatgcgacgttcgacggcgccgatgacgtg
atcacgatcgatggcctgcgcgtggagtacccagatggtttcgggctcgcacgctcatcc
aataccacgcctgtggttgtgatgcgctttgaggctgacaatgatgccgcgctcaagcgg
atccaggaggactttaggcgtgtgatcattgcgcagaagccggacgcaaaactcccgttc
tag

DBGET integrated database retrieval system