KEGG   Burkholderia rhizoxinica: RBRH_01957Help
Entry
RBRH_01957        CDS       T01355                                 

Definition
Alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
brh  Burkholderia rhizoxinica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RBRH_01957
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBRH_01957
  Lipid metabolism
   00071 Fatty acid degradation
    RBRH_01957
  Amino acid metabolism
   00350 Tyrosine metabolism
    RBRH_01957
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RBRH_01957
   00626 Naphthalene degradation
    RBRH_01957
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RBRH_01957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(233200..234231)
Genome map
AA seq 343 aa AA seqDB search
MAMKQSMKAAVVHAFGEPLRIEEVAVPTPGPAQILVNVKASGVCHTDLHAADGDWPVKPT
LPFIPGHEGVGYVAAVGKGVKIAKEGDRVGVPWLYTACGHCEYCLGGWETLCHVQQNTGY
SVNGGYAEYVLADPNYVGRLPDQVAFDEIAPILCAGVTVYKGIRVTDTRPGQWLAISGIG
GLGHVAVQYANAMGLHVVAVDVVPDKLELAKRLGAKLVVDASATDPAAFIQKEIGGVHGV
LVTAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNAITVRGSIVGTRRDLQE
ALDFAAQGLVHAHIHHERLENINLVFGKLREGKVDGRIVLTLD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtggccatgaagcaatcgatgaaggccgcggtcgtgcatgcgtttggtgagccgctgcgg
attgaagaagtcgcggtgccgacgccgggtcccgctcagatactggtcaatgtcaaagcg
tccggagtctgccacactgacctgcatgcggccgacggcgactggccggtcaagcccacg
ctgccatttatcccaggccacgagggcgtcggctacgtcgccgcagtcggaaaaggggtc
aagatcgccaaagaaggcgaccgggtcggcgtaccgtggctctacaccgcatgcggacac
tgcgagtattgcctgggcggctgggaaacgctgtgtcacgtgcagcaaaacaccggttat
tcggtcaatggcggctatgccgaatatgtattggctgacccgaattatgtcggtcggctc
ccggaccaggtcgccttcgatgagatcgcgcctattctgtgtgccggcgtcaccgtctac
aaaggcatacgggtcaccgacacgcgtccaggccaatggctggcgatatcaggcatcggc
ggattagggcatgtcgctgtgcaatatgcgaacgcgatgggtttgcatgttgtcgcggtt
gatgttgtgccggacaaactggagttggcaaaacggcttggcgccaaactcgtcgtggac
gcgtcagccaccgatccagcagcgttcattcagaaagaaatcggcggcgtacacggcgtg
ctggttaccgcggtgtcacgcagtgcgttcgctcaggcgctcggcatggtgcgacgcggt
ggcaccgtatcgcttaatggtctgccgccgggcgactttccactgccgattttttcgacg
gtgctcaatgccatcaccgtacgcggctcgatcgtcggtacgcggcgcgacctgcaggaa
gcgctcgatttcgcggcgcaggggctggtgcacgcgcacatccaccacgaacgactggag
aacatcaatttggtgtttggcaagctgcgcgaaggtaaggtcgacgggcgtatcgtgctg
acgctcgattga

DBGET integrated database retrieval system