KEGG   Paraburkholderia rhizoxinica: RBRH_02148Help
Entry
RBRH_02148        CDS       T01355                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00900  Terpenoid backbone biosynthesis
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RBRH_02148
Enzymes [BR:brh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RBRH_02148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBW76132
UniProt: E5ALV8
Position
2515696..2516598
Genome map
AA seq 300 aa AA seqDB search
MTETEDMLRDCAAPAKLNLFLHVTGRREDGYHELQTVFQLLDWSDMLHFRRRDDGTVRHL
RPLDGVPEQADLSVRAAKLLQQHSGCRYGVEIDIDKRLPMGAGIGGGSSDAATTLLALNR
LWRLHLPRATLQALALELGADVPFFVFGRNAFAQGVGEQLQPVQLPARTFLVVKPAVHVP
TAEIFRSDALTRDTKRITITDFLAQQNIAEDNKASETGWPDHFGRNDMQPVVAGKYAEVA
QVLDWFSTIARARMTGSGASVFAAFPSRAEAELAQAKLPVSWQSAIASSLDRHPLYTFAS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaccgaagacatgctgcgcgactgcgcagcccctgcgaagctgaaccttttc
ctacatgtgaccggccgccgcgaggacggataccacgaactgcagacggtgttccagttg
ctggactggagcgacatgctgcatttccggcgccgcgacgatggcacggtgcgccacctg
cggccattggacggagtccccgagcaggctgacttaagcgttcgagcggcgaagctgctg
caacagcacagcggttgccgctacggtgtggagatcgacatcgacaagcgcctgccaatg
ggagccggcatcggcggcggcagctcggatgcggcaaccacgctgctcgcgttgaaccgg
ctgtggcggctgcatctgccgcgtgcgacgctgcaagccctggcactagaactgggcgcc
gacgtgccgttcttcgtgttcgggcgcaatgcatttgcgcaaggcgtgggcgagcaactg
caaccggttcagctgccggcacgcacgttcctggtggttaaacccgcagtgcatgtgccg
accgctgaaattttccgatccgatgcattgacaagagacaccaaacgcatcacaattacg
gactttcttgcacagcaaaacatcgctgaggacaacaaggcaagcgagacgggttggccg
gatcattttggccgaaacgacatgcagccggttgtcgcaggaaaatacgcagaagtggcg
caagtgttggattggttttcgacaatcgcgcgcgcacgtatgacgggatcgggtgcgagt
gtattcgcagcatttcccagcagggcggaagcggagttggcgcaagcaaagctccccgtc
agctggcaaagtgcgatagcatcaagcctggaccgccatccgctgtacactttcgcgtca
taa

DBGET integrated database retrieval system