KEGG   Burkholderia rhizoxinica: RBRH_02197Help
Entry
RBRH_02197        CDS       T01355                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
brh  Burkholderia rhizoxinica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:brh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:brh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:brh00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:brh00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:brh00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2549903..2550703
Genome map
AA seq 266 aa AA seqDB search
MDRRAPAAYRFLTTVDIDMYKLVLIRHGESTWNKENRFTGWVDVDLTDKGAAEARQAGVL
LKQAGYTFDIAYTSMLKRAIRTLWHVQDEMDLMYIPVVHSWRLNERHYGALSGLNKAETA
AQYGDEQVLIWRRSYDTPPPALEPSDPRTSYDDPRYTKVARELLPLTECLKDTVARVLPI
WNESIAPAIKSGRNVLIAAHGNSIRALVKYLDGISDIDIVGLNIPNGVPLVYELDEALKP
IKHYYLGDAEAIANAQAAVANQGKAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttggatcggcgtgcgccggcggcttaccgcttcctgactaccgttgacattgacatgtac
aagctcgtcctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttcactggc
tgggtcgacgtcgacctcaccgacaaaggcgcggccgaagcgcggcaagccggcgtgctg
cttaagcaggccggctacacgttcgacatcgcgtatacgtccatgctcaagcgcgccatc
cgcacgctgtggcacgtgcaggatgaaatggatctgatgtatatccccgtcgtgcactcg
tggcgcctgaacgagcggcactacggcgcgctgtccgggctgaacaaggctgaaacggca
gcccagtacggtgacgagcaggtgctgatatggcggcgcagctacgatacgccaccgccg
gcgctcgagccgtccgatccgcgcacctcgtacgatgacccgcgctacaccaaggtggcg
cgcgagttgctgccgctcacggagtgcctgaaggacacggtcgcgcgcgtgctgccaatc
tggaacgaatcgatcgcgccggccatcaagtcgggccgcaacgtgttaatcgccgcgcat
ggcaactcgatccgcgcgctggtcaaatacctggacggcatctcagacatcgatatcgtc
gggctgaacatcccgaacggcgtgccgctcgtctacgagttggacgaagcgctcaaaccc
atcaagcactattatctaggtgacgcagaggcgatcgccaacgcgcaggccgcggtcgcg
aaccagggtaaggctgcctaa

DBGET integrated database retrieval system