KEGG   Burkholderia rhizoxinica: RBRH_02197Help
Entry
RBRH_02197        CDS       T01355                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
brh  Burkholderia rhizoxinica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RBRH_02197
   01230 Biosynthesis of amino acids
    RBRH_02197
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBRH_02197
  Energy metabolism
   00680 Methane metabolism
    RBRH_02197
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RBRH_02197
Enzymes [BR:brh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RBRH_02197
Exosome [BR:brh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RBRH_02197
  Exosomal proteins of melanoma cells
   RBRH_02197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2549903..2550703
Genome map
AA seq 266 aa AA seqDB search
MDRRAPAAYRFLTTVDIDMYKLVLIRHGESTWNKENRFTGWVDVDLTDKGAAEARQAGVL
LKQAGYTFDIAYTSMLKRAIRTLWHVQDEMDLMYIPVVHSWRLNERHYGALSGLNKAETA
AQYGDEQVLIWRRSYDTPPPALEPSDPRTSYDDPRYTKVARELLPLTECLKDTVARVLPI
WNESIAPAIKSGRNVLIAAHGNSIRALVKYLDGISDIDIVGLNIPNGVPLVYELDEALKP
IKHYYLGDAEAIANAQAAVANQGKAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttggatcggcgtgcgccggcggcttaccgcttcctgactaccgttgacattgacatgtac
aagctcgtcctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttcactggc
tgggtcgacgtcgacctcaccgacaaaggcgcggccgaagcgcggcaagccggcgtgctg
cttaagcaggccggctacacgttcgacatcgcgtatacgtccatgctcaagcgcgccatc
cgcacgctgtggcacgtgcaggatgaaatggatctgatgtatatccccgtcgtgcactcg
tggcgcctgaacgagcggcactacggcgcgctgtccgggctgaacaaggctgaaacggca
gcccagtacggtgacgagcaggtgctgatatggcggcgcagctacgatacgccaccgccg
gcgctcgagccgtccgatccgcgcacctcgtacgatgacccgcgctacaccaaggtggcg
cgcgagttgctgccgctcacggagtgcctgaaggacacggtcgcgcgcgtgctgccaatc
tggaacgaatcgatcgcgccggccatcaagtcgggccgcaacgtgttaatcgccgcgcat
ggcaactcgatccgcgcgctggtcaaatacctggacggcatctcagacatcgatatcgtc
gggctgaacatcccgaacggcgtgccgctcgtctacgagttggacgaagcgctcaaaccc
atcaagcactattatctaggtgacgcagaggcgatcgccaacgcgcaggccgcggtcgcg
aaccagggtaaggctgcctaa

DBGET integrated database retrieval system