KEGG   Burkholderia rhizoxinica: RBRH_02293Help
Entry
RBRH_02293        CDS       T01355                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
brh  Burkholderia rhizoxinica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:brh01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:brh00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021549..1022871
Genome map
AA seq 440 aa AA seqDB search
MAIKIRKLDSSDASFKPALAAVLAFEASEDEAIERSVAQILADVKLRGDAAVLEYTKRFD
RLDVDSVASLELPAARLQVALDALEPKCRAALEAAAARVHAYHDKQKIECGSHSWQYTEA
DGTVLGQKVTPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVREIVMVVPTPDGMANDLV
LAAALLGGVDRVLTIGGAQAIGALAYGTDTIPAVDKICGPGNAYVAAAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPRWVAMDLFSQAEHDELAQSILLCPDAVFIRRVEEAIDQLIGTL
PRRDVVTRSLQDRGALIKVRDMAEACAIANDIAPEHLEVSALEPHQWVQHIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFLKRSSVIEVSAEGAQTLGEIAAELA
YGEGLQAHARSAEYRMKAGG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaagatccgcaaactcgactcctccgatgctagtttcaagccggcgttggcg
gccgtgctcgcattcgaggcgagcgaagacgaagcgatcgagcgctcggtcgcgcagatc
ttagctgacgtcaaattacgcggcgatgccgctgtgctggaatacacgaagcgttttgac
cggctggacgtggacagcgttgcgtccctggaattgccagctgcccggctgcaggtggca
ctggacgcgctggagcccaaatgccgggcagcgttggaggcggcggcggcgcgcgtgcac
gcgtatcacgacaagcagaagatcgaatgcggcagccacagctggcagtacaccgaggcg
gatggtacggtgctcggccaaaaggtcacgccgctggaccgcgtcggcttgtacgtgccc
ggcggcaaggcagcctacccgtcatcggtgctgatgaatgcgattccggcgcgcgtggct
ggcgtgcgcgaaatcgtgatggtggtgccgacgccggacggcatggccaatgaccttgtg
ctggctgccgcgctacttggcggcgtggaccgggtgttgaccatcgggggcgcccaggcc
atcggcgcactcgcctacggtacggacacgatcccggccgtggacaagatctgcggaccg
ggcaatgcctacgttgccgccgccaagcgacgggtgttcggcacggtcggcatcgacatg
atcgcgggtccgtcggagattctggtgttgtgcgatggcaccaccgacccgcgttgggtc
gcgatggatttattttcgcaggccgagcacgatgaactcgcgcagtcgatcctgttgtgt
ccggacgccgtgttcatccggcgcgtcgaggaggcgatcgaccagttgatcgggacgctg
ccgcggcgcgacgtggtcacccgttcgctgcaggatcgcggcgcgttgatcaaggtccga
gacatggccgaggcatgcgcaatcgccaacgacatcgcgccggagcacctggaggtgtcg
gcgctcgagccgcatcaatgggtgcagcacattcgccatgctggcgcgatcttcctaggc
cgctacacgagcgagagcctcggcgactattgtgcgggtccgaaccacgtgctgccgact
tcccggaccgcgcgtttctcgtcgccgttgggcgtgtatgactttctgaagcgctcgagc
gtgattgaggtgagcgccgaaggggcgcagacgctcggtgaaattgccgcggaactcgcg
tatggcgagggcctgcaggcgcacgcgcgcagcgccgagtatcggatgaaggccggcggc
tga

DBGET integrated database retrieval system