KEGG   Burkholderia rhizoxinica: RBRH_02293Help
Entry
RBRH_02293        CDS       T01355                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
brh  Burkholderia rhizoxinica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RBRH_02293
  Amino acid metabolism
   00340 Histidine metabolism
    RBRH_02293
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RBRH_02293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1021549..1022871
Genome map
AA seq 440 aa AA seqDB search
MAIKIRKLDSSDASFKPALAAVLAFEASEDEAIERSVAQILADVKLRGDAAVLEYTKRFD
RLDVDSVASLELPAARLQVALDALEPKCRAALEAAAARVHAYHDKQKIECGSHSWQYTEA
DGTVLGQKVTPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVREIVMVVPTPDGMANDLV
LAAALLGGVDRVLTIGGAQAIGALAYGTDTIPAVDKICGPGNAYVAAAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPRWVAMDLFSQAEHDELAQSILLCPDAVFIRRVEEAIDQLIGTL
PRRDVVTRSLQDRGALIKVRDMAEACAIANDIAPEHLEVSALEPHQWVQHIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFLKRSSVIEVSAEGAQTLGEIAAELA
YGEGLQAHARSAEYRMKAGG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaagatccgcaaactcgactcctccgatgctagtttcaagccggcgttggcg
gccgtgctcgcattcgaggcgagcgaagacgaagcgatcgagcgctcggtcgcgcagatc
ttagctgacgtcaaattacgcggcgatgccgctgtgctggaatacacgaagcgttttgac
cggctggacgtggacagcgttgcgtccctggaattgccagctgcccggctgcaggtggca
ctggacgcgctggagcccaaatgccgggcagcgttggaggcggcggcggcgcgcgtgcac
gcgtatcacgacaagcagaagatcgaatgcggcagccacagctggcagtacaccgaggcg
gatggtacggtgctcggccaaaaggtcacgccgctggaccgcgtcggcttgtacgtgccc
ggcggcaaggcagcctacccgtcatcggtgctgatgaatgcgattccggcgcgcgtggct
ggcgtgcgcgaaatcgtgatggtggtgccgacgccggacggcatggccaatgaccttgtg
ctggctgccgcgctacttggcggcgtggaccgggtgttgaccatcgggggcgcccaggcc
atcggcgcactcgcctacggtacggacacgatcccggccgtggacaagatctgcggaccg
ggcaatgcctacgttgccgccgccaagcgacgggtgttcggcacggtcggcatcgacatg
atcgcgggtccgtcggagattctggtgttgtgcgatggcaccaccgacccgcgttgggtc
gcgatggatttattttcgcaggccgagcacgatgaactcgcgcagtcgatcctgttgtgt
ccggacgccgtgttcatccggcgcgtcgaggaggcgatcgaccagttgatcgggacgctg
ccgcggcgcgacgtggtcacccgttcgctgcaggatcgcggcgcgttgatcaaggtccga
gacatggccgaggcatgcgcaatcgccaacgacatcgcgccggagcacctggaggtgtcg
gcgctcgagccgcatcaatgggtgcagcacattcgccatgctggcgcgatcttcctaggc
cgctacacgagcgagagcctcggcgactattgtgcgggtccgaaccacgtgctgccgact
tcccggaccgcgcgtttctcgtcgccgttgggcgtgtatgactttctgaagcgctcgagc
gtgattgaggtgagcgccgaaggggcgcagacgctcggtgaaattgccgcggaactcgcg
tatggcgagggcctgcaggcgcacgcgcgcagcgccgagtatcggatgaaggccggcggc
tga

DBGET integrated database retrieval system