KEGG   Burkholderia rhizoxinica: RBRH_02441Help
Entry
RBRH_02441        CDS       T01355                                 

Definition
Anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
brh  Burkholderia rhizoxinica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RBRH_02441
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RBRH_02441
Enzymes [BR:brh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RBRH_02441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
758785..759822
Genome map
AA seq 345 aa AA seqDB search
MNNRKCQYGPVMFDVAGTSLSRDDVRRIADPLTGGVILFARNYASRAQLLELTGAIRDVR
DDVIIAVDQEGGRVQRFREDGFTSLPPMRVLGALWNDDALAAIRVATAIGYVMASELRAS
GLDLSFAPVLDLDYGHAKAIGDRAFHADPRVVALLAKSVAHGLALAGMAACGKHFPGHGY
VEADSHVEAPVDTRALDEILGCDAQPYQWLGLSLAAVMPAHVVYPAVDARPAGFSGVWLQ
QILRGRLGFNGVIFSDDLSMEAARQAGTTAEAAHAALDAGCDMVLVCNRPEDADDVLQRL
RARVIDTASRRRIKRLAPRGGAPKWSELMRQPDYCQARELIDSLR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaatcgcaagtgccaatatggtccggtgatgttcgatgtcgccggcacttcgttg
agtcgtgacgatgtccgccggatcgccgatccgctgaccggcggcgtgattttgttcgcc
cgcaattatgcaagccgcgcgcaactgctcgagctgaccggcgcaatccgcgatgtgcgc
gacgacgtgatcattgcggtggaccaagagggcgggcgcgtgcagcgtttccgggaggat
gggttcacgtcgctgccgccgatgcgcgtcctgggcgcgttatggaacgacgatgcactc
gcggcgattcgagtggccacggcgatcggctatgtgatggcatcggagttgcgcgcgagc
ggcctcgacttgagctttgcaccggtgcttgacctcgactacgggcacgcgaaggcgatc
ggcgatcgcgcgttccacgcggatccgcgcgtcgtcgcgctgttggccaaaagcgtcgca
catggcttggcgctggccggaatggcagcctgcggcaagcactttccggggcacggctac
gtggaggcggattcgcatgtcgaggcgcctgtcgatacccgcgcgctcgacgagattctc
ggctgcgatgcgcagccgtatcaatggcttgggctgtcgctggccgcggtgatgccggcc
cacgtcgtctatccggccgtcgatgcccggccggccggcttctcgggcgtgtggctgcag
cagatcctgcgcggcaggcttgggttcaatggcgtgatcttcagcgacgatttgtcgatg
gaggcggcgcgccaggccgggaccaccgccgaggccgcgcacgcggcgctcgatgccgga
tgcgacatggtgctcgtgtgcaatcgtcccgaagacgccgacgatgtgctgcagcgcctg
cgcgcgcgcgtcatcgatacggcgtcccggcgccgcatcaagcggctcgcaccccgcggc
ggcgcgccaaagtggagcgaactgatgcgccaacccgactattgccaagcgcgcgagctg
atcgacagtctgcggtga

DBGET integrated database retrieval system