KEGG   Burkholderia rhizoxinica: RBRH_02522Help
Entry
RBRH_02522        CDS       T01355                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
brh  Burkholderia rhizoxinica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RBRH_02522
   01230 Biosynthesis of amino acids
    RBRH_02522
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBRH_02522
   00051 Fructose and mannose metabolism
    RBRH_02522
   00562 Inositol phosphate metabolism
    RBRH_02522
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RBRH_02522
Enzymes [BR:brh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RBRH_02522
Exosome [BR:brh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RBRH_02522
  Exosomal proteins of bladder cancer cells
   RBRH_02522
  Exosomal proteins of melanoma cells
   RBRH_02522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2104561..2105406)
Genome map
AA seq 281 aa AA seqDB search
MHGFCLLIDACTHRSTRPMSKQQRSKLVVGNWKMHGRVADNDALLHALVQRVATLGPQVR
LGVCVPHPYLAQAQARLAGTPIAYGAQDVSAHTQGAYTGEVAAPMVAEFGATLAIVGHSE
RRALHAESSELVAAKARRALEAGMTPIVCVGETLDERQAGQTDSVVRAQLAAVLDALDET
DVARLVVAYEPVWAIGTGQSATAQQAQQVHAALRAQLTAKAGAQVPLLYGGSVKPGNAQE
LFSQADIDGGLIGGASLSATDFLAIGAAAAAALAGDPAHSR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgcacggcttttgcttattgattgacgcgtgcacgcacagatccacgagacccatgtcg
aagcaacaacgatcgaagctggtagtcggaaactggaagatgcacggccgcgtcgctgac
aacgatgcgctgctgcacgcgctcgtgcaacgcgtggcgacactcgggccgcaggtgcgg
ctcggcgtgtgtgtgccgcatccgtatctcgcccaggcccaggcgcgccttgccggtacg
cccatcgcatatggcgcgcaggatgtgtccgcgcatacgcagggcgcgtataccggtgag
gtcgccgccccgatggttgccgagtttggtgcgacgctggcgatcgtcggccactcggag
cgccgcgcgttgcatgcggaatcgtcggagttggtggcggccaaggcgcggcgtgcactc
gaggccggtatgacgccgatcgtctgcgtcggcgaaacgctggatgagcggcaggccggg
cagaccgacagcgtcgtgcgtgcgcagcttgcagcggtgctcgacgcgctggacgagacc
gacgtggcacggctggtggtggcatacgagccggtctgggccatcggtactggtcagagt
gcgacggcgcagcaagcacagcaggtccacgccgcgttgcgggcgcagctcacggccaag
gcaggggcgcaggtgccgctgctgtacggcggtagcgtgaagccgggtaatgcacaggaa
ttgttttcgcaggcggatatcgacggcggcctgattggtggcgcatcgttatccgcgacc
gatttccttgcgatcggcgcggcggcggccgcggcactcgccggggatccggctcattct
aggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system