KEGG   Burkholderia rhizoxinica: RBRH_02522Help
Entry
RBRH_02522        CDS       T01355                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
brh  Burkholderia rhizoxinica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:brh01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:brh01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:brh00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:brh00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:brh00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:brh00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2104561..2105406)
Genome map
AA seq 281 aa AA seqDB search
MHGFCLLIDACTHRSTRPMSKQQRSKLVVGNWKMHGRVADNDALLHALVQRVATLGPQVR
LGVCVPHPYLAQAQARLAGTPIAYGAQDVSAHTQGAYTGEVAAPMVAEFGATLAIVGHSE
RRALHAESSELVAAKARRALEAGMTPIVCVGETLDERQAGQTDSVVRAQLAAVLDALDET
DVARLVVAYEPVWAIGTGQSATAQQAQQVHAALRAQLTAKAGAQVPLLYGGSVKPGNAQE
LFSQADIDGGLIGGASLSATDFLAIGAAAAAALAGDPAHSR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgcacggcttttgcttattgattgacgcgtgcacgcacagatccacgagacccatgtcg
aagcaacaacgatcgaagctggtagtcggaaactggaagatgcacggccgcgtcgctgac
aacgatgcgctgctgcacgcgctcgtgcaacgcgtggcgacactcgggccgcaggtgcgg
ctcggcgtgtgtgtgccgcatccgtatctcgcccaggcccaggcgcgccttgccggtacg
cccatcgcatatggcgcgcaggatgtgtccgcgcatacgcagggcgcgtataccggtgag
gtcgccgccccgatggttgccgagtttggtgcgacgctggcgatcgtcggccactcggag
cgccgcgcgttgcatgcggaatcgtcggagttggtggcggccaaggcgcggcgtgcactc
gaggccggtatgacgccgatcgtctgcgtcggcgaaacgctggatgagcggcaggccggg
cagaccgacagcgtcgtgcgtgcgcagcttgcagcggtgctcgacgcgctggacgagacc
gacgtggcacggctggtggtggcatacgagccggtctgggccatcggtactggtcagagt
gcgacggcgcagcaagcacagcaggtccacgccgcgttgcgggcgcagctcacggccaag
gcaggggcgcaggtgccgctgctgtacggcggtagcgtgaagccgggtaatgcacaggaa
ttgttttcgcaggcggatatcgacggcggcctgattggtggcgcatcgttatccgcgacc
gatttccttgcgatcggcgcggcggcggccgcggcactcgccggggatccggctcattct
aggtga

DBGET integrated database retrieval system