KEGG   Burkholderia rhizoxinica: RBRH_02549Help
Entry
RBRH_02549        CDS       T01355                                 

Definition
hypothetical protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
brh  Burkholderia rhizoxinica
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    RBRH_02549
Enzymes [BR:brh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     RBRH_02549
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     RBRH_02549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2083101..2083913
Genome map
AA seq 270 aa AA seqDB search
MSHTTQTARSMTVSAIGGIPLIQTGDDLGQIIKEAIHKNGIALENGDVLVLAQKIVSKSE
GRWAALSSVTPGKQAIDLAQKVDKDPRLVELILSESAEIVAHRQDGVLITAHRLGCVMAN
AGIDHSNVGDEDSVLLLPKDPDHSARELKKQFHRLCGVDVHIIINDSFGRVWRHGTAGCA
IGVAGFSPLKNYIGKPDLFGQLLRTTQVAVADELAAAASFLMGQADEGSPVVLIRGANLP
PADGTVQQLIRPKEEDLFRETSSTLAVEMA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagccacactacacaaacagcaagaagcatgactgtatccgccatcggtggcattccc
ttaatacaaacaggggatgatcttggccagattattaaggaggcgatccacaaaaacggt
atcgctctagaaaatggcgacgtgttagtgcttgcgcaaaagatcgtttcaaagtccgaa
ggacgatgggctgcactatcttctgtcacgcccggcaaacaagctatcgatttggcgcag
aaagtggataaagatccacggctcgttgaactgatcctatcggagtcggcagaaatcgtt
gcacacaggcaagacggtgtactgatcaccgctcaccgtctcggatgcgtgatggcgaat
gccggtatcgatcattccaatgttggtgatgaagacagtgtgcttctgcttccgaaagac
ccggatcacagtgcacgcgaattaaaaaaacagtttcatcgcttgtgcggcgtcgatgtc
cacatcatcatcaacgatagttttggcagagtgtggcgccatggcacggcaggatgcgca
atcggtgtagcgggcttttccccgcttaaaaattatattgggaagccggatctgtttggg
carctcttacgaacaacccaagtggcagtggccgatgaactcgccgcagcagcgtctttc
ttaatgggacaagccgatgaaggatcgcctgttgtgctgatccgcggcgcgaatttgccc
cccgctgatggaacggtccagcagcttattcgccccaaagaggaagatttatttcgtgaa
acctcctccacactggcggtggaaatggcctaa

DBGET integrated database retrieval system