KEGG   Burkholderia rhizoxinica: RBRH_03191Help
Entry
RBRH_03191        CDS       T01355                                 

Definition
Guanyl-specific ribonuclease (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
brh  Burkholderia rhizoxinica
Brite
Enzymes [BR:brh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     RBRH_03191
Transfer RNA biogenesis [BR:brh03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    RBRH_03191
 Prokaryotic Type
    RBRH_03191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
359211..359606
Genome map
AA seq 131 aa AA seqDB search
MVVYASSSRNEIQDRQVAPLRRACGDRVRHQRAWLGFHRVGANLLPSDASIGASLGEVSI
AGLPGEVQFTFQSIQAGGPFPYPKDGEVFGHVERHLPVRPRDYSHEYTVKTPRASSRRTK
NRLRKSAALYR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtatacgcgtcctcttcgcgaaacgagatacaggatcggcaagtggctccgtta
cgccgtgcttgcggtgaccgtgtccgccaccagcgtgcctggcttggtttccaccgcgtg
ggcgcgaacttgctgccgtcggacgcgtccattggcgcctcgctcggcgaggtgtcgatt
gccgggctgcccggtgaagtgcagttcacgttccaatcgatccaggccggcggcccgttc
ccttatccaaaggatggcgaggtgttcggtcatgtcgagcgccacctgccggtgcgaccc
cgtgactattctcacgagtacacggtgaagacgccgcgcgcgtcatcgcgcagaacaaag
aatcgtctgcgcaagagtgccgcgttatatcggtga

DBGET integrated database retrieval system