KEGG   Burkholderia rhizoxinica: RBRH_03191Help
Entry
RBRH_03191        CDS       T01355                                 

Definition
Guanyl-specific ribonuclease (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
brh  Burkholderia rhizoxinica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
359211..359606
Genome map
AA seq 131 aa AA seqDB search
MVVYASSSRNEIQDRQVAPLRRACGDRVRHQRAWLGFHRVGANLLPSDASIGASLGEVSI
AGLPGEVQFTFQSIQAGGPFPYPKDGEVFGHVERHLPVRPRDYSHEYTVKTPRASSRRTK
NRLRKSAALYR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtatacgcgtcctcttcgcgaaacgagatacaggatcggcaagtggctccgtta
cgccgtgcttgcggtgaccgtgtccgccaccagcgtgcctggcttggtttccaccgcgtg
ggcgcgaacttgctgccgtcggacgcgtccattggcgcctcgctcggcgaggtgtcgatt
gccgggctgcccggtgaagtgcagttcacgttccaatcgatccaggccggcggcccgttc
ccttatccaaaggatggcgaggtgttcggtcatgtcgagcgccacctgccggtgcgaccc
cgtgactattctcacgagtacacggtgaagacgccgcgcgcgtcatcgcgcagaacaaag
aatcgtctgcgcaagagtgccgcgttatatcggtga

DBGET integrated database retrieval system