KEGG   Burkholderia rhizoxinica: RBRH_03261Help
Entry
RBRH_03261        CDS       T01355                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diami nopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
brh  Burkholderia rhizoxinica
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RBRH_03261
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RBRH_03261
Enzymes [BR:brh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     RBRH_03261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292889..294421
Genome map
AA seq 510 aa AA seqDB search
MSRSPLTPEQIERVRAEVLAWLRARLAPHAQLRVDSRAVCAGDAFVAYAVDSADSRAYIA
DALQRGAAAVLVQAGGEFPGGGPVLQVPELDQLAGHIASAWYGEPSRDMLMVGITGTNGK
TTTSHWVAGALSGSGTRCAIIGTLGTGLPGQLSPTGFTTPDAPQVHHSLAALRAHGASAV
SMEVSSHALHQGRVNGVAFDIAVFTNLTQDHLDYHKDLASYEAAKARLFDWPGLRAAVIN
RDDEAGRRLIGHLATRVRTISYGIASTRPRGDASLHAMAIRATATGTAFTVVSDWGHAEL
EVGTLGLFNVANLLAVLGVLLAADVPFDAALSQITRLEPVNGRMQQLGGRPQVDEPLVVV
DYAHTPDALEKTLDALRPIATQRGGKLVCVFGCGGERDATKRPLMGAIAERLADSVIVTS
DNPRSEPPLAIIGQIVSAMREPARVRTIEDRAGAILQAVRGASAADVVLIAGKGHEATQE
VMGKKRPFSDQDHAHLALASRVTQPRGEAE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgctcgccactgacgcccgaacaaatcgagcgcgtgcgggccgaggtgctcgcg
tggctgcgcgctcggcttgcgccgcatgcgcaattgcgggtggacagccgcgcggtgtgc
gctggcgacgcgttcgtcgcgtatgcggtggacagcgcagacagtcgtgcgtatatcgcc
gatgcgttgcagcgtggcgcggcagccgtgctggtccaggccggcggtgagttcccgggc
ggcggaccggtgctccaggtccctgaactcgatcagcttgcgggccacattgctagtgcg
tggtatggcgagccgagtcgcgacatgctgatggtcggcatcacgggcaccaatggcaag
accaccaccagccactgggtcgcgggcgcgttgagcggcagtggcacccgttgcgcgatc
atcggcacgttgggcaccggactgccggggcagctttcgcccaccgggttcacgaccccc
gacgcgccgcaggtgcaccacagcctggcggcgctgcgtgcgcacggcgcaagcgcggta
tcgatggaggtgtcctcgcacgcactgcaccaggggcgcgtgaatggcgtcgcgttcgac
atcgcggtgttcactaacctgacgcaggaccatctcgactatcacaaggacctcgcgtcg
tacgaggccgccaaagcgcggctgttcgactggccgggcttgcgcgcggcagtcatcaat
cgcgacgacgaggccgggcgcaggctgatcgggcatctggccacgcgggtgcgcacgatt
tcgtacggtatcgcgtcgactaggccgcgcggcgacgcttcgctgcatgcgatggcgatc
cgcgcgaccgccaccggcaccgccttcacggtggtatccgactgggggcacgccgagctc
gaagtgggcacgctcggcctgttcaatgtcgccaatttgctcgccgtcctcggcgtgcta
ctggccgccgacgtgccattcgatgcggcgctgtctcagatcacgcggctggaaccggtc
aacggtcggatgcagcagctcggcgggcggccgcaagtggacgagccgctggtggttgtc
gattacgcgcatacgccggacgcattggaaaaaacgctcgacgcactgcggccgatcgcc
acgcagcggggcggcaagctcgtctgtgtgttcggctgtgggggcgagcgcgatgcgacc
aagcggccgctgatgggggcgattgccgagcggctcgccgacagcgtcatcgtgacgagt
gacaacccgcgtagcgagccgccgctggcaatcatcggccaaatcgtcagtgcgatgcgt
gagccggcacgcgtgcgcaccatcgaggatcgcgctggcgcgatcctgcaggcggtgcgt
ggtgcgtcggccgccgacgtcgtgctgatcgccggcaagggacatgaggcaacacaggaa
gtgatgggtaagaagcggccgttttcggatcaggatcatgcacacctcgcgctcgcatcg
cgcgtcacgcaacctcgcggagaagctgaatga

DBGET integrated database retrieval system