KEGG   Paraburkholderia rhizoxinica: RBRH_03438Help
Entry
RBRH_03438        CDS       T01355                                 

Definition
(GenBank) Nucleoside-diphosphate-sugar epimerases
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
brh  Paraburkholderia rhizoxinica
Brite
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     RBRH_03438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_4 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NmrA RmlD_sub_bind Polysacc_synt_2 DFP adh_short KR Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: CBW76994
UniProt: E5AV71
Position
pBRH01:complement(593770..594765)
Genome map
AA seq 331 aa AA seqDB search
MSVRVLVTGASGFVGSALARAALARGYRVRALVRASSPRGNLRDLDIELAEGDMRDVASV
ERALDQVDVLFHVAADYRLWARDSHEIMRANADGTRCVMQAALRRRVERVVYTSSVATLR
VSGATGPLDETAPADEASTIGVYKRSKVAAERIVEQMVAQQGLPAVIVNPSTPIGPRDIK
PTPTGRIIVEAATGKIPAFVDTGLNLVHVDDVAQGHLLAMDHGRIGERYILGGDDVLLRE
MLAAIARMVGRKPPSIELPRWPLYPIALAAQGLAQWTGREPFVTVDALRMSRYHMFFSSA
KARRELGYRARPHSDGLRDALDWFRTNGYLR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtccgcgtgctggtgaccggcgcgtccggtttcgttggctcggcgctggcccgg
gccgcgctcgcgcgcggctatcgtgttcgcgcgctggtgcgggcgagcagcccgcgtggc
aacttgcgcgacctggatatcgagctggccgaaggcgacatgcgcgatgtcgcatcggtc
gagcgcgcgctcgatcaggtcgatgtgttattccacgtggcggccgactaccggttgtgg
gcgcgcgacagtcatgaaatcatgcgtgctaacgccgacggaacccgttgcgtgatgcag
gcagcgctgcgtcggcgtgttgaacgtgtcgtctacacgagcagcgtcgcgacactgcgc
gtgagcggcgccaccggtccgctcgacgagaccgcgccggccgacgaggcgagcacgatc
ggcgtctacaagcgcagcaaggtggccgccgagcgtatcgtcgagcagatggtcgcgcag
caagggctgccggcggtaatcgtgaacccgtcgacgccgatcggaccgcgtgacatcaag
cctacgccgaccggacgcatcattgtcgaggcggcgaccggcaaaattccggccttcgtc
gataccggcttgaatctcgtgcatgtggacgatgtcgcacagggccatctgcttgcaatg
gaccatggacggatcggcgagcgctatatcctcggcggcgacgatgtgctgctgcgcgag
atgctggcggcgatcgcgcggatggtcgggcgcaagccgccgtcgatcgagttgccgcgc
tggccgttgtatccgattgcgttagcggcgcaaggcctcgcgcagtggacgggccgcgag
ccgttcgtgaccgtcgatgcattgcggatgtcgcgttatcacatgttttttagttccgcg
aaggcgcggcgcgagctgggctatcgcgcccgccctcatagcgatggtttgcgcgatgcg
ctcgactggtttcgcaccaacggctacttgaggtga

DBGET integrated database retrieval system