KEGG   Paraburkholderia rhizoxinica: RBRH_03569Help
Entry
RBRH_03569        CDS       T01355                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00900  Terpenoid backbone biosynthesis
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RBRH_03569
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RBRH_03569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CBW75028
UniProt: E5AQZ6
Position
1391171..1392400
Genome map
AA seq 409 aa AA seqDB search
MMTQHCVTLLGSTGSIGDSTLDVIARHPDRFSIHALTAHRNWEKLAEQCVRFAPHVAVVG
DARTAMQLQARLREAGCATRVDYGRDALAAAASDAACNTVVAAIVGAAGLEPTLAAARAG
KRILLANKEALVMSGALFMDAVYASGAALLPVDSEHNAIFQCFPREPGLRGAVTRIQLTA
SGGPFRLREPATLVDVTPEQACKHPNWVMGRKISVDSATMMNKGLEVIEARWLFDLRPEQ
IDVLIHPQSVIHSLVSYADGSTLAQLGHPDMRTPIAYALAFPTRIVSGVEPLDLAQVATL
TFEPPDYERFPCLALALQALRDGGSASTVLNAANEVAVEAFLARHIGFTAIAAVVSDVLE
QVQADIATTLDAVLDVDAQARRAAQEALARHRTRDRSSVRGGAAASQLG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacgcaacattgtgtgaccctgctgggctcgacgggctcgatcggcgatagcacg
ctggacgtgatcgcccggcatccggatcgattctcgatccacgcgttgactgcgcaccgc
aactgggaaaaactcgctgagcaatgcgtgcgcttcgcgccacacgtcgcggtggtcggc
gatgcgcgaacggccatgcagttgcaggcgcggctgcgcgaggcgggctgtgcgacgcgc
gttgactacggccgcgacgcactggccgccgccgcgtcggacgccgcttgcaatacggtg
gtcgccgctattgtgggtgcggccgggctggagccgacgctggcagcggcgcgtgccggc
aagcggatcttgctcgcgaacaaggaggcgctggtgatgtccggcgcattgttcatggac
gcagtctatgccagtggcgctgcgctgctacccgttgacagtgagcacaacgccattttc
cagtgctttccgcgcgagcctggtttgcgcggcgccgtgacccggatccagctgaccgcg
tccggcggtccattccggctgcgtgaaccggctacgctggttgacgtgacgccggagcag
gcgtgcaagcatccgaactgggtcatggggcgcaagatctcggtcgattcggccacgatg
atgaacaagggcctcgaggtgatcgaggcgcgctggctgttcgatctgcggcccgagcag
atcgatgtgttgatccatccgcaaagtgtgatccattcgctggtgtcgtatgcggatggc
tcgacactcgcgcaactgggccatcccgatatgcgcacgccgatcgcttatgcactggcg
tttccgacgcggatcgtgtcgggcgtcgagccgctggatctggcgcaggtggcgacgttg
acctttgagccgcccgactacgagcgctttccgtgtctggcgctcgcgctgcaggcattg
cgcgacggcggctcggcgagcacggtattgaacgcggcgaacgaagtcgcggtcgaagcg
tttcttgcgcgacacatcggatttaccgcgatcgcggcagtcgtcagtgacgtgctcgag
caagtccaggctgatattgccacgacgctggatgcggtgctcgacgtcgatgcgcaggcg
cgccgtgcggcacaagaggcgctggcccgtcaccgtacgcgtgaccggtctagcgtgcgt
ggcggggcggcggctagccagctgggctga

DBGET integrated database retrieval system