KEGG   Burkholderia rhizoxinica: RBRH_03591Help
Entry
RBRH_03591        CDS       T01355                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
brh  Burkholderia rhizoxinica
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:brh01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:brh00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1367561..1368700)
Genome map
AA seq 379 aa AA seqDB search
MSRTLALTEALIGRASVTPEDAGCQALMAERLVALGFTCETIAEGGVTNLWALKRGADGP
AGKLLAFAGHTDVVPTGPLEQWRSDPFVPVRRDGRLYGRGAADMKASLAAFVVAAEEFVA
AHPQHRGSIGLLITSDEEGPARYGTVKVVERLEARGERLDYCVVGEPTSSERFGDTVKNG
RRGSLSGTLTVRGIQGHIAYPHLAKNPVHLLAPALAELVRVAWDQGNEYFPPTTWQISNL
HAGTGATNIIPGSASIDFNFRFSTATTPDELKARVHAILDAHGLDYTLTWNLSGMPFLTP
RGELSNALEQAIEAETGIRPVLSTTGGTSDGRFIARICKQVIEFGPCNASIHKVDEHIEL
AHIEPLKNVYRGVLERLVV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcacgcttgccctgaccgaggccctaatcggccgagcgtccgtcacgcccgag
gacgccggctgccaggcattgatggctgagcgcctcgtggcgctcggcttcacctgcgaa
accattgccgagggcggtgtcaccaacctgtgggcgctcaagcgcggcgctgacggcccg
gcgggcaagctgctggcgttcgccggccacaccgacgtggtgccgaccgggccgctcgag
caatggcgcagcgatccattcgtcccggtgcgacgcgacggccgactatacggacgcggc
gcagctgacatgaaggcgtcgctggccgcctttgtcgtcgccgccgaggaattcgtcgcc
gcccatccgcagcaccgcggctcgatcggcctgctgatcaccagcgatgaggagggaccg
gcgcgctatggcacggtcaaggtagtcgagcggcttgaagcgcgcggcgaacgcctggac
tactgcgtggtcggcgagccgacctccagcgagcgcttcggcgacacggtgaagaacggg
cgacgcggctcgctgtctggcacgttaaccgtgcgtggcatacagggtcatatcgcgtac
ccgcacttagccaagaatccggtgcacctgctcgcgcccgcgctggctgagctcgtgcgc
gtagcatgggaccagggcaacgaatacttcccaccgaccacgtggcagatatcgaacctg
catgccggaactggcgcgaccaatatcatcccgggcagcgcgagtatcgacttcaacttc
cgcttctcgaccgcgacgacgcccgacgagttgaaagcgcgcgtgcacgcgatcctcgac
gcccacggactggactacacattgacgtggaacctgagcggcatgccgttcctcacaccg
cgcggcgagctgtccaacgcgctcgagcaggcgatcgaggccgagaccggcatacgcccc
gtgctctcgaccaccggcggcacctccgatggccgctttattgcgcgaatctgcaagcag
gtcatcgagtttggcccgtgtaacgcgtcgatccacaaggtcgatgaacatatcgagttg
gcccacattgagccactgaaaaacgtttatcggggcgtactggagcgtctcgtcgtgtga

DBGET integrated database retrieval system