KEGG   Burkholderia rhizoxinica: RBRH_03596Help
Entry
RBRH_03596        CDS       T01355                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
brh  Burkholderia rhizoxinica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RBRH_03596
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RBRH_03596
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RBRH_03596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1362254..1362895
Genome map
AA seq 213 aa AA seqDB search
MVEADHGRGPSWRCVERHYCRSARHRTVVRPADAEQPGVALHCTYYLVFVQGVQMSQLYS
FSARSLQGDDISLERYRGKVLLIVNTASECGFTPQYAGLQALYERYAARGLEILGFPCNQ
FGKQEPGDAQQIGAFCAKNYQVTFPMFDKIDVNGAHAHPLYRYLTGEAPGVLGTEAIKWN
FTKFLIDREGRPVKRYAPVTKPDAIEPDIEKLL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttggttgaagcggatcacggcagaggaccatcatggagatgcgtggaaagacattattgt
agatcggcccggcatcggacagtggtgcgtccggccgatgccgagcagcccggagttgct
ctacactgcacgtattacctcgtgttcgtacaaggagtccagatgagccagctttattca
ttctctgcgcgctcgctgcagggcgacgacatttcgctggagcgttaccgcggcaaggtc
ctgctaatcgtcaataccgccagtgaatgcgggttcacgccgcaatatgcggggttgcag
gctttgtatgagcgatatgcggcgcgcggcctggagatattgggctttccgtgcaaccag
tttggcaaacaggaaccgggcgacgcgcagcagatcggcgcattttgcgcgaaaaactac
caggtcacgttcccgatgtttgacaagatcgatgtcaacggcgcccatgcgcacccgctg
tatcgctatttgaccggggaagcgcccggcgtgctcgggaccgaggcgatcaagtggaac
ttcaccaagtttttgatcgatcgggaaggcaggccggtcaagcgctatgcgcctgtcacc
aagcccgacgcgatcgagccggatatcgaaaagttgctttga

DBGET integrated database retrieval system