KEGG   Paraburkholderia rhizoxinica: RBRH_03596Help
Entry
RBRH_03596        CDS       T01355                                 

Definition
(GenBank) Glutathione peroxidase (EC 1.11.1.9)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00480  Glutathione metabolism
brh00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RBRH_03596
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RBRH_03596
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RBRH_03596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CBW75005
UniProt: E5AQX3
Position
1362254..1362895
Genome map
AA seq 213 aa AA seqDB search
MVEADHGRGPSWRCVERHYCRSARHRTVVRPADAEQPGVALHCTYYLVFVQGVQMSQLYS
FSARSLQGDDISLERYRGKVLLIVNTASECGFTPQYAGLQALYERYAARGLEILGFPCNQ
FGKQEPGDAQQIGAFCAKNYQVTFPMFDKIDVNGAHAHPLYRYLTGEAPGVLGTEAIKWN
FTKFLIDREGRPVKRYAPVTKPDAIEPDIEKLL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttggttgaagcggatcacggcagaggaccatcatggagatgcgtggaaagacattattgt
agatcggcccggcatcggacagtggtgcgtccggccgatgccgagcagcccggagttgct
ctacactgcacgtattacctcgtgttcgtacaaggagtccagatgagccagctttattca
ttctctgcgcgctcgctgcagggcgacgacatttcgctggagcgttaccgcggcaaggtc
ctgctaatcgtcaataccgccagtgaatgcgggttcacgccgcaatatgcggggttgcag
gctttgtatgagcgatatgcggcgcgcggcctggagatattgggctttccgtgcaaccag
tttggcaaacaggaaccgggcgacgcgcagcagatcggcgcattttgcgcgaaaaactac
caggtcacgttcccgatgtttgacaagatcgatgtcaacggcgcccatgcgcacccgctg
tatcgctatttgaccggggaagcgcccggcgtgctcgggaccgaggcgatcaagtggaac
ttcaccaagtttttgatcgatcgggaaggcaggccggtcaagcgctatgcgcctgtcacc
aagcccgacgcgatcgagccggatatcgaaaagttgctttga

DBGET integrated database retrieval system