KEGG   Burkholderia rhizoxinica: RBRH_03623Help
Entry
RBRH_03623        CDS       T01355                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
brh  Burkholderia rhizoxinica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RBRH_03623
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBRH_03623
  Amino acid metabolism
   00310 Lysine degradation
    RBRH_03623
Enzymes [BR:brh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RBRH_03623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339886..1341274
Genome map
AA seq 462 aa AA seqDB search
MLAPPEPCAASSGAWSHDTARYVFRIMTMAIVEVKVPQLSESVSEATMLQWKKQPGEAVA
QDEILIEIETDKVVLEVPAPAAGVLAQVIKHDGDTVVADEVIAKIDTEAKAGTAAGATAT
ETAAAAAGAEVKPAPQTSPTPAAQPVAAGGASGAIASPAASKLLAEKNLSAGQLSGTGRD
GRVTKGDVLAAGAAPAAKPAAPASVTAKAAPSRAALPQVAAPGADTWLTDRPEQRVPMSR
LRARIAERLLESQQTNAILTTFNEVNMAPVMDLRSKYKDRFEKEHGVKLGFMSFFVKAAV
HALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQMSLADIEKKIAEFG
AKARDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGVHATKERPVVENGQIV
IRPINYLALSYDHRIIDGREAVLSLVAMKEALEDPARLLLDL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcccccggagccgtgcgccgcgtcttcaggcgcctggtcgcacgatacggca
cgatacgtattcaggataatgacgatggctattgttgaagttaaagttccgcagctttcg
gagtcggtgtccgaagccacgatgctccagtggaagaagcaaccgggggaagcggttgcg
caagatgaaattctgatcgagattgagaccgataaggtcgtgctcgaagtgccggcgccg
gctgcgggcgtgctcgctcaagtgatcaagcacgatggcgacacggtcgttgccgatgag
gtgatcgccaagatcgataccgaagcgaaggctggcaccgcagcgggcgcgacggcgacg
gaaacagccgcagccgccgccggcgccgaagtgaaaccggcgccgcaaacttcgccgact
cccgcggcgcaaccggttgcggccggcggcgccagcggcgcaatcgcgtcgccggccgcc
tcgaagctgctcgcggagaagaacctgagtgccggccaactgagtggcaccggccgcgac
ggtcgggtgacgaagggggacgtgctggcagctggcgcagcgccggccgctaagccggcc
gcgccggccagcgtgaccgcgaaggcggcgccgtcgcgcgccgcgttgccgcaggtcgcc
gcgccgggtgcggacacctggctgacggaccgtccggaacagcgcgtgccgatgtcacgg
ctgcgcgcgcgaatcgccgagcgtctgctcgagtcgcaacaaaccaacgcgatcctgacc
acgttcaacgaagtgaacatggcgccggtcatggatctgcgcagcaagtacaaggatcgc
ttcgagaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcggccgtg
catgcgctgaagaagttcccgctcgtgaacgcgtcgatcgatggcaacgacatcgtttac
cacggctacttcgatatcggcatcgcggtcggatcgccgcgcggtctggtcgtgccgatc
ctgcgtaatgcagatcaaatgagtcttgcggacatcgagaagaagatcgccgagttcggt
gcgaaagcccgagacggcaagctatcgatcgaggaaatgaccggcggcacgttctcgatc
tcgaacggcggcgtgtttggctcgatgctgtcgacgccgatcatcaacccgccacaatcg
gcgattctcggcgtgcatgcgacgaaggagcggccagtcgtcgaaaacggccagatcgtg
atccgtccgattaactaccttgcactgtcgtacgatcaccggatcatcgacggtcgcgag
gctgtgctgtcgctcgttgcaatgaaggaagcgctggaagatccggcacgcttgctgctc
gacctttaa

DBGET integrated database retrieval system