KEGG   Paraburkholderia rhizoxinica: RBRH_03623Help
Entry
RBRH_03623        CDS       T01355                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00020  Citrate cycle (TCA cycle)
brh00310  Lysine degradation
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01120  Microbial metabolism in diverse environments
brh01130  Biosynthesis of antibiotics
brh01200  Carbon metabolism
Module
brh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
brh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBRH_03623
  Amino acid metabolism
   00310 Lysine degradation
    RBRH_03623
Enzymes [BR:brh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RBRH_03623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CBW74979
UniProt: E5AQU7
Position
1339886..1341274
Genome map
AA seq 462 aa AA seqDB search
MLAPPEPCAASSGAWSHDTARYVFRIMTMAIVEVKVPQLSESVSEATMLQWKKQPGEAVA
QDEILIEIETDKVVLEVPAPAAGVLAQVIKHDGDTVVADEVIAKIDTEAKAGTAAGATAT
ETAAAAAGAEVKPAPQTSPTPAAQPVAAGGASGAIASPAASKLLAEKNLSAGQLSGTGRD
GRVTKGDVLAAGAAPAAKPAAPASVTAKAAPSRAALPQVAAPGADTWLTDRPEQRVPMSR
LRARIAERLLESQQTNAILTTFNEVNMAPVMDLRSKYKDRFEKEHGVKLGFMSFFVKAAV
HALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQMSLADIEKKIAEFG
AKARDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGVHATKERPVVENGQIV
IRPINYLALSYDHRIIDGREAVLSLVAMKEALEDPARLLLDL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcccccggagccgtgcgccgcgtcttcaggcgcctggtcgcacgatacggca
cgatacgtattcaggataatgacgatggctattgttgaagttaaagttccgcagctttcg
gagtcggtgtccgaagccacgatgctccagtggaagaagcaaccgggggaagcggttgcg
caagatgaaattctgatcgagattgagaccgataaggtcgtgctcgaagtgccggcgccg
gctgcgggcgtgctcgctcaagtgatcaagcacgatggcgacacggtcgttgccgatgag
gtgatcgccaagatcgataccgaagcgaaggctggcaccgcagcgggcgcgacggcgacg
gaaacagccgcagccgccgccggcgccgaagtgaaaccggcgccgcaaacttcgccgact
cccgcggcgcaaccggttgcggccggcggcgccagcggcgcaatcgcgtcgccggccgcc
tcgaagctgctcgcggagaagaacctgagtgccggccaactgagtggcaccggccgcgac
ggtcgggtgacgaagggggacgtgctggcagctggcgcagcgccggccgctaagccggcc
gcgccggccagcgtgaccgcgaaggcggcgccgtcgcgcgccgcgttgccgcaggtcgcc
gcgccgggtgcggacacctggctgacggaccgtccggaacagcgcgtgccgatgtcacgg
ctgcgcgcgcgaatcgccgagcgtctgctcgagtcgcaacaaaccaacgcgatcctgacc
acgttcaacgaagtgaacatggcgccggtcatggatctgcgcagcaagtacaaggatcgc
ttcgagaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcggccgtg
catgcgctgaagaagttcccgctcgtgaacgcgtcgatcgatggcaacgacatcgtttac
cacggctacttcgatatcggcatcgcggtcggatcgccgcgcggtctggtcgtgccgatc
ctgcgtaatgcagatcaaatgagtcttgcggacatcgagaagaagatcgccgagttcggt
gcgaaagcccgagacggcaagctatcgatcgaggaaatgaccggcggcacgttctcgatc
tcgaacggcggcgtgtttggctcgatgctgtcgacgccgatcatcaacccgccacaatcg
gcgattctcggcgtgcatgcgacgaaggagcggccagtcgtcgaaaacggccagatcgtg
atccgtccgattaactaccttgcactgtcgtacgatcaccggatcatcgacggtcgcgag
gctgtgctgtcgctcgttgcaatgaaggaagcgctggaagatccggcacgcttgctgctc
gacctttaa

DBGET integrated database retrieval system