KEGG   Burkholderia rhizoxinica: RBRH_03672Help
Entry
RBRH_03672        CDS       T01355                                 

Definition
molybdopterin biosynthesis MoeA protein
Orthology
K03750  
molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
brh  Burkholderia rhizoxinica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1292573..1293979
Genome map
AA seq 468 aa AA seqDB search
MRRRGYSAGATIRLYSSTSGPNPMSIPNDTAPVAWASQTAGAATATDAIHPPRLSTQDAL
AQLLAAAFPSCVQPDAVEIVPTQDALNRVLAADIRSALDVPPADISAMDGYAVRAADVVA
GRPMRVSQRVPAGHAPSGALQAGTAARVFTGARLPAGADTVVMQEQAHAHGETVAFDAPP
PMGEWINRRGSDIRKDAVILPAGTRLTPQALGLAASVGCATLPLARRPRVAIAFTGDELT
MPGEPLREGAIYNSSRFTLGGLLAALGCDVTDLGIVPDRLDATRDVLREAALAHDLILTS
GGVSVGEADHVRAAVQAEGSLHLWQIAMKPGKPLAFGTVRRPAAAGPSCAGAPHDAAFFI
GLPGNPVSSFVTFLLFVRPFILRLAGTRCVEPRALRMRADFTQKKADRRNEFLRARINEA
GGLDLFPNQSSAVLTSTVWGDGLIDNPPGHAIQAGETVRFLPFSTLLA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcgccgcggctacagcgccggggctacaatacgtctttattcgtcaacatccggc
ccgaatccgatgtcgatcccgaacgataccgcgccggtggcgtgggctagccaaacggcc
ggcgccgccacggccacggacgccatccacccaccacggctgtccacgcaggacgcgctt
gcgcagttgctggccgcggcgtttccatcctgcgtgcagcctgacgcggtcgagatagtg
ccgacgcaagacgcgctgaaccgcgtgttggccgccgacattcgctcggcgctcgatgtg
ccgccggccgacatcagcgcgatggacggctacgcggtgcgggccgccgacgtcgtggcc
gggcggccgatgcgcgtgtcacaacgcgtgccagctggccatgcgcccagtggagcgctc
caggccggcaccgcggcgcgcgttttcaccggtgcgcgactgcccgcgggcgccgacacg
gtagtgatgcaggagcaggcgcatgcacatggcgagacggtcgcgttcgacgcgccgccg
ccaatgggcgagtggatcaaccggcgtggttcggatatccgcaaggatgcggtgatcctg
cccgccggcacgcggctaacgccgcaggcgttgggcctggccgcgtcggtcggctgtgcg
acgctgccgctcgcgcgacggccgagggtcgcgatagcctttaccggcgacgagttgacg
atgccgggcgagccgttgcgtgaaggcgcaatttacaattcgagccggttcacgctcggt
ggactgctggccgcactcggctgcgacgtgacggatcttggtattgtgccggaccggctc
gatgcgacgcgcgatgtgctgcgtgaggcggcgcttgcgcatgacctgatcctcacctcc
ggtggtgtatcggtgggcgaggcggatcacgtgcgggccgcggtgcaggctgaaggttcg
ctgcacctgtggcagatcgcgatgaagccgggcaagccgcttgcattcggcacggtgcgc
cgaccggcagctgcggggccatcgtgcgccggcgcgccgcacgacgcggcgttcttcatc
ggcttgcctggcaatccggtgtccagcttcgtgacgttcctgttgtttgtgcgtccgttc
atcctgcgcctagccggcacgagatgcgtcgagcctcgtgcgctgcgcatgcgggccgat
ttcacgcaaaagaaggcggatcgccgcaatgaattcctgcgcgcgcggatcaacgaggct
ggaggcctggacctgttcccgaatcaaagctcggcggtgctgacatcgacagtgtggggg
gacggattgatcgacaatccccctgggcatgcgatccaggcgggtgagacggtgcgtttc
ctgccattctcgacgttgctggcgtaa

DBGET integrated database retrieval system