KEGG   Burkholderia rhizoxinica: RBRH_03673Help
Entry
RBRH_03673        CDS       T01355                                 

Definition
Threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
brh  Burkholderia rhizoxinica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RBRH_03673
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RBRH_03673
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RBRH_03673
Enzymes [BR:brh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RBRH_03673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1291110..1292561
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGLGERHSFSDILLGGLAKDGGLYLPAQYPRVSDAELSRWRTLSYADLAFEI
LAKFCDDMPADDLRALTRRTYRADVYSNVRAGSDAQRITPLKTLGVEGGAPLALLELSNG
PTLAFKDMAMQLLGNLFEYVLTRHDQQLNILGATSGDTGSAAEYAMRGKRGVRVFMLSPH
RKMSAFQTAQMFSLQDPNIFNIAVEGVFDDCQDIVKAVSNDHAFKARYQIGTVNSINWAR
VVAQVVYYFRGYFDATRGNDQRVSFTVPSGNFGNICAGHIARMMGLPIDKLVVATNENDV
LDEFFRTGTYRVRVGAETYQTTSPSMDISKASNFERFIFDLLGRDSARVLQLFRDVEVKG
GFDLAASGDFARVREFGFVSGRSTHADRIATIRDVHRRYQAMIDTHTADGVKVAREYLEP
GVPMIVLETAQPIKFGDTIREALDQDPARPPAFEGLEALPQRFTVLPADAERVKDFIRAQ
IDG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatttccacgcgcggcgccgggctcggcgagcgccattcattttccgacatc
ctactcggcggtcttgcgaaggatggtggcctgtatttgccggcgcagtatccgcgtgtg
tccgacgctgagttgtcccgctggcgtacgctgtcctatgcggacctggcattcgagata
ctcgcaaaattttgcgacgacatgccggccgacgacttgcgggcgctgacgcggcgcact
tatcgcgccgacgtgtattcaaacgtgcgcgccggcagcgatgcgcagcgcatcacgccg
ctcaagacgctgggcgtcgagggcggcgcgccgctggcgctgctcgagctgtccaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaacctgttcgagtacgtg
ttgacgcgccatgaccagcaattgaacatccttggcgcgacgtctggcgacaccggcagc
gccgccgaatacgcgatgcgcggcaagcggggcgtgcgtgtgtttatgttgtcaccgcat
cgcaagatgagcgcgttccagaccgcgcagatgttcagcctgcaggacccgaacatcttt
aatattgcggtcgaaggggtgtttgatgattgccaggacatcgtcaaggccgtctcgaac
gaccacgcgttcaaggcccgctatcaaattggcacggtcaactcgatcaactgggcccgg
gtcgtcgcacaggttgtctactattttcgaggctatttcgatgcgacgcgcggcaacgac
cagcgcgtgtcattcaccgtcccgtcgggcaatttcggcaatatatgtgctggccacatt
gcgcggatgatgggcttgccgatcgataagctggtggttgccaccaatgagaacgacgtg
ctcgacgagttcttccgtaccggtacgtatcgcgtgcgcgtcggggctgaaacctaccag
acgaccagtcccagcatggacatctcaaaggcgtcgaactttgagcgcttcatcttcgac
ttgctgggccgcgattcggcgcgcgtgttgcagttgtttcgcgacgtcgaggtcaagggc
gggttcgacttggccgcgtcgggtgattttgcccgcgtgcgtgagttcggtttcgtgtcc
ggtcgcagcacgcacgcggatcggatcgcgacgatccgcgacgtccaccgtcgctaccag
gcgatgatcgacacgcatacagcggacggcgtgaaagtggcgcgcgaatatctagaaccg
ggggtgccgatgatcgtgctcgagaccgcgcagccgatcaagttcggcgacacgatccgt
gaggcgctggaccaggatcctgcgcgcccgccggcctttgagggactggaggcgttgccg
cagcgtttcactgtattgccggccgacgccgagcgtgtgaaggacttcattcgcgcgcag
atcgacggctag

DBGET integrated database retrieval system