KEGG   Burkholderia rhizoxinica: RBRH_03743Help
Entry
RBRH_03743        CDS       T01355                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
brh  Burkholderia rhizoxinica
Brite
Enzymes [BR:brh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RBRH_03743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1220622..1221527
Genome map
AA seq 301 aa AA seqDB search
MDAWLAAGAACMSAGRAKRFPLGLSDVMREPRGAPVLPGVAGSASASTATKPTLGGTRPR
EGVEQMRPFFDRMVPASPAAVPLSTQLALTSERVRQRMVERVRASGVADARVLAALAAIP
RHQFVDPGLAAQAYEDAALPIGHQQTISKPSVVARMLELVAAGHALEKVLEIGTGCGYQA
AVLSHLARDVYSVERVKPLYERAKTNLRPLRVPNIRLHYGDGRLGLPSAAPFDAIVIAAA
GFDVPAALLEQLAIGGRLVAPVGSRSGNEQVLTLVERVSSAQWRESQLDRVFFVPLKSGV
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgtggttggcggccggagcagcctgcatgagcgccgggcgcgccaagcggttc
ccgctcgggctgtccgacgtgatgcgcgagccgcgcggtgcgccagtcctgcccggcgtg
gccggatccgcgtccgccagcaccgcgaccaagcccacgctgggcggcacgcgcccgcgc
gaaggcgtcgagcagatgcggccgttttttgacagaatggtgccggcttcgcccgcggcc
gtgcccttgtcgacgcaactggcgctgacctcggaacgcgttcggcaacggatggtcgaa
cgcgtgcgcgcgagcggcgtcgccgacgcacgcgtgcttgccgcgctcgcggcgataccc
cggcaccagttcgtcgatcctgggcttgccgcgcaggcctatgaggatgccgcgctgccc
atcgggcatcagcaaacgatctccaagccgtcagtggtcgcgcgcatgctggaattggtg
gcagccgggcacgcactggagaaagtattggagatcggcacgggctgcggatatcaagcg
gcagtactgagccacctggcgcgcgacgtgtattcggtcgaacgggtaaagccattgtac
gaacgggcgaaaacgaacctgcgtccgttgcgcgtgccgaacatccggctgcattacggc
gatgggcggctcggcttgccaagcgccgcgccgttcgatgccatcgtgattgctgccgca
ggcttcgatgtgccggccgcgctactcgagcaattggccatcggcggccgcctggtggcg
ccggtgggctcacgcagtggcaacgaacaggtgctcacgctggtcgagcgcgtgtccagc
gcgcagtggcgggagtcacagcttgatcgtgttttctttgtccccttaaaatcgggagtg
atttga

DBGET integrated database retrieval system