KEGG   Burkholderia rhizoxinica: RBRH_03747Help
Entry
RBRH_03747        CDS       T01355                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
brh  Burkholderia rhizoxinica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:brh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RBRH_03747
DNA repair and recombination proteins [BR:brh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RBRH_03747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1218410..1219012
Genome map
AA seq 200 aa AA seqDB search
MNVKPPSALAALIEALRTLPGVGPKSAQRIAYHLMQHDRDGAQRLGRSLLHATQALKHCE
RCNTFTERDVCELCSDEQRDPTLLCVVETPADQVMLEQTLAYCGLYFVLMGRLSPLDGIG
PREIHFERLMRRATDGVVSEVVLATNFTNEGEATAHYLGQMLKARGLTVTRLARGVPVGG
ELEYVDAGTIARAVLDRRSV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgaagccaccgtccgcgctggccgcgctgatcgaagcgctgcgcacgttgccc
ggtgtcggaccgaagtccgcgcagcgcattgcctatcacctgatgcagcatgaccgggat
ggggcacagcggctcgggcggtcgctgctgcacgcgacgcaggcgctcaagcattgcgag
cggtgtaacacgttcaccgagcgcgacgtatgcgagctatgcagtgacgagcagcgcgat
ccgacgctgttgtgcgtggtcgagacacccgccgaccaagtcatgctcgagcagacgctc
gcgtattgcggactgtattttgtgctgatggggcgcttgagcccgcttgacggtatcggg
ccgcgcgagatccatttcgaacggctgatgcgccgggcgaccgacggcgtggtcagtgaa
gttgtgctggccaccaatttcacgaatgaaggcgaggcgactgcccattacctaggccag
atgcttaaggcgcgcggcctgacggtgacgcggctggcccgcggcgtgcctgtcggcggt
gaactcgaatatgtcgacgccggcacaatcgcccgcgcggtactggaccggcgctcggtc
tga

DBGET integrated database retrieval system